Sample 3300008849

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Sample 3300008849

3300008849: Microbial communities of surface water sampled in Lagrangian time series from North Pacific Subtropical Gyre - BioLINCS_ESP_2023

Overview

Basic Information
IMG/M Taxon OID	3300008849 Open in IMG/M
GOLD Reference (Study \| Sequencing Project \| Analysis Project)	Gs0117986 \| Gp0126486 \| Ga0103897
Sample Name	Microbial communities of surface water sampled in Lagrangian time series from North Pacific Subtropical Gyre - BioLINCS_ESP_2023
Sequencing Status	Permanent Draft
Sequencing Center	Massachusetts Institute of Technology
Published?	N
Use Policy	Open

Dataset Contents
Total Genome Size	5744552
Sequencing Scaffolds	1
Novel Protein Genes	1
Associated Families	1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Eukaryota → Sar	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
Name	Microbial Communities Of Surface Water Sampled In Lagrangian Time Series From North Pacific Subtropical Gyre
Type	Environmental
Taxonomy	Environmental → Aquatic → Marine → Oceanic → Unclassified → Surface Ocean Water → Microbial Communities Of Surface Water Sampled In Lagrangian Time Series From North Pacific Subtropical Gyre

Alternative Ecosystem Assignments
Environment Ontology (ENVO)	marine biome → marine water body → surface water
Earth Microbiome Project Ontology (EMPO)	Free-living → Saline → Water (saline)

Location Information
Location	North Pacific Ocean
Coordinates	Lat. (^o)	N/A	Long. (^o)	N/A	Alt. (m)	N/A	Depth (m)	N/A
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F010768	Metagenome / Metatranscriptome	299	Y

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
Ga0103897_100175	All Organisms → cellular organisms → Eukaryota → Sar	800	Open in IMG/M

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0103897_100175	Ga0103897_1001752	F010768	MKEVLNGGYNVHPVPPPNSEIKERITRRYERKRIKIEKLFTLGYTTSGDP*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.