Basic Information | |
---|---|
Family ID | F009579 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 316 |
Average Sequence Length | 41 residues |
Representative Sequence | MSGVELVLAFLAGVVMGGALDRFVLPLLVDAWIDRLRRHGR |
Number of Associated Samples | 205 |
Number of Associated Scaffolds | 315 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 54.43 % |
% of genes near scaffold ends (potentially truncated) | 17.41 % |
% of genes from short scaffolds (< 2000 bps) | 77.85 % |
Associated GOLD sequencing projects | 190 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.51 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (54.430 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment (21.519 % of family members) |
Environment Ontology (ENVO) | Unclassified (31.329 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Unclassified (35.127 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 55.07% β-sheet: 0.00% Coil/Unstructured: 44.93% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.51 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 315 Family Scaffolds |
---|---|---|
PF01510 | Amidase_2 | 11.11 |
PF00196 | GerE | 3.49 |
PF12697 | Abhydrolase_6 | 1.59 |
PF08281 | Sigma70_r4_2 | 0.95 |
PF00440 | TetR_N | 0.95 |
PF01243 | Putative_PNPOx | 0.95 |
PF13649 | Methyltransf_25 | 0.95 |
PF01476 | LysM | 0.95 |
PF09719 | C_GCAxxG_C_C | 0.63 |
PF06224 | HTH_42 | 0.63 |
PF04075 | F420H2_quin_red | 0.63 |
PF00486 | Trans_reg_C | 0.63 |
PF13748 | ABC_membrane_3 | 0.63 |
PF13565 | HTH_32 | 0.63 |
PF05199 | GMC_oxred_C | 0.63 |
PF04191 | PEMT | 0.63 |
PF00403 | HMA | 0.63 |
PF01850 | PIN | 0.63 |
PF16983 | MFS_MOT1 | 0.63 |
PF01061 | ABC2_membrane | 0.63 |
PF14329 | DUF4386 | 0.63 |
PF13683 | rve_3 | 0.63 |
PF01872 | RibD_C | 0.63 |
PF02518 | HATPase_c | 0.63 |
PF08241 | Methyltransf_11 | 0.63 |
PF09851 | SHOCT | 0.63 |
PF13481 | AAA_25 | 0.32 |
PF01297 | ZnuA | 0.32 |
PF02604 | PhdYeFM_antitox | 0.32 |
PF01555 | N6_N4_Mtase | 0.32 |
PF07452 | CHRD | 0.32 |
PF13418 | Kelch_4 | 0.32 |
PF13847 | Methyltransf_31 | 0.32 |
PF13635 | DUF4143 | 0.32 |
PF00962 | A_deaminase | 0.32 |
PF06736 | TMEM175 | 0.32 |
PF12680 | SnoaL_2 | 0.32 |
PF00155 | Aminotran_1_2 | 0.32 |
PF02652 | Lactate_perm | 0.32 |
PF01326 | PPDK_N | 0.32 |
PF01402 | RHH_1 | 0.32 |
PF07992 | Pyr_redox_2 | 0.32 |
PF13701 | DDE_Tnp_1_4 | 0.32 |
PF08818 | DUF1801 | 0.32 |
PF00557 | Peptidase_M24 | 0.32 |
PF12728 | HTH_17 | 0.32 |
PF08327 | AHSA1 | 0.32 |
PF00211 | Guanylate_cyc | 0.32 |
PF02661 | Fic | 0.32 |
PF03992 | ABM | 0.32 |
PF00144 | Beta-lactamase | 0.32 |
PF01867 | Cas_Cas1 | 0.32 |
PF06897 | DUF1269 | 0.32 |
PF01638 | HxlR | 0.32 |
PF00296 | Bac_luciferase | 0.32 |
PF02452 | PemK_toxin | 0.32 |
PF01053 | Cys_Met_Meta_PP | 0.32 |
PF07676 | PD40 | 0.32 |
PF14534 | DUF4440 | 0.32 |
PF00999 | Na_H_Exchanger | 0.32 |
PF12840 | HTH_20 | 0.32 |
PF07883 | Cupin_2 | 0.32 |
PF01934 | HepT-like | 0.32 |
PF06863 | DUF1254 | 0.32 |
PF00724 | Oxidored_FMN | 0.32 |
PF09360 | zf-CDGSH | 0.32 |
PF01663 | Phosphodiest | 0.32 |
PF12710 | HAD | 0.32 |
PF00884 | Sulfatase | 0.32 |
PF04439 | Adenyl_transf | 0.32 |
PF01545 | Cation_efflux | 0.32 |
PF07366 | SnoaL | 0.32 |
PF00126 | HTH_1 | 0.32 |
PF13407 | Peripla_BP_4 | 0.32 |
PF11188 | DUF2975 | 0.32 |
COG ID | Name | Functional Category | % Frequency in 315 Family Scaffolds |
---|---|---|---|
COG1985 | Pyrimidine reductase, riboflavin biosynthesis | Coenzyme transport and metabolism [H] | 0.63 |
COG2217 | Cation-transporting P-type ATPase | Inorganic ion transport and metabolism [P] | 0.63 |
COG2303 | Choline dehydrogenase or related flavoprotein | Lipid transport and metabolism [I] | 0.63 |
COG2608 | Copper chaperone CopZ | Inorganic ion transport and metabolism [P] | 0.63 |
COG3214 | DNA glycosylase YcaQ, repair of DNA interstrand crosslinks | Replication, recombination and repair [L] | 0.63 |
COG0262 | Dihydrofolate reductase | Coenzyme transport and metabolism [H] | 0.63 |
COG1041 | tRNA G10 N-methylase Trm11 | Translation, ribosomal structure and biogenesis [J] | 0.32 |
COG1230 | Co/Zn/Cd efflux system component | Inorganic ion transport and metabolism [P] | 0.32 |
COG1518 | CRISPR-Cas system-associated integrase Cas1 | Defense mechanisms [V] | 0.32 |
COG1620 | L-lactate permease | Energy production and conversion [C] | 0.32 |
COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 0.32 |
COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.32 |
COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 0.32 |
COG1816 | Adenosine/6-amino-6-deoxyfutalosine deaminase | Nucleotide transport and metabolism [F] | 0.32 |
COG1902 | 2,4-dienoyl-CoA reductase or related NADH-dependent reductase, Old Yellow Enzyme (OYE) family | Energy production and conversion [C] | 0.32 |
COG1921 | Seryl-tRNA(Sec) selenium transferase | Translation, ribosomal structure and biogenesis [J] | 0.32 |
COG1982 | Arginine/lysine/ornithine decarboxylase | Amino acid transport and metabolism [E] | 0.32 |
COG2008 | Threonine aldolase | Amino acid transport and metabolism [E] | 0.32 |
COG2114 | Adenylate cyclase, class 3 | Signal transduction mechanisms [T] | 0.32 |
COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 0.32 |
COG2161 | Antitoxin component YafN of the YafNO toxin-antitoxin module, PHD/YefM family | Defense mechanisms [V] | 0.32 |
COG2189 | Adenine specific DNA methylase Mod | Replication, recombination and repair [L] | 0.32 |
COG2337 | mRNA-degrading endonuclease MazF, toxin component of the MazEF toxin-antitoxin module | Defense mechanisms [V] | 0.32 |
COG2361 | HEPN domain protein, predicted toxin of MNT-HEPN system | Defense mechanisms [V] | 0.32 |
COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 0.32 |
COG2445 | Uncharacterized HEPN domain protein YutE, UPF0331/DUF86 family | General function prediction only [R] | 0.32 |
COG2873 | O-acetylhomoserine/O-acetylserine sulfhydrylase, pyridoxal phosphate-dependent | Amino acid transport and metabolism [E] | 0.32 |
COG3004 | Na+/H+ antiporter NhaA | Energy production and conversion [C] | 0.32 |
COG3263 | NhaP-type Na+/H+ and K+/H+ antiporter with C-terminal TrkAC and CorC domains | Energy production and conversion [C] | 0.32 |
COG3548 | Uncharacterized membrane protein | Function unknown [S] | 0.32 |
COG3965 | Predicted Co/Zn/Cd cation transporter, cation efflux family | Inorganic ion transport and metabolism [P] | 0.32 |
COG4100 | Cystathionine beta-lyase family protein involved in aluminum resistance | Inorganic ion transport and metabolism [P] | 0.32 |
COG4118 | Antitoxin component of toxin-antitoxin stability system, DNA-binding transcriptional repressor | Defense mechanisms [V] | 0.32 |
COG4430 | Uncharacterized conserved protein YdeI, YjbR/CyaY-like superfamily, DUF1801 family | Function unknown [S] | 0.32 |
COG4651 | Predicted Kef-type K+ transport protein, K+/H+ antiporter domain | Inorganic ion transport and metabolism [P] | 0.32 |
COG4803 | Uncharacterized membrane protein | Function unknown [S] | 0.32 |
COG5361 | Uncharacterized conserved protein | Mobilome: prophages, transposons [X] | 0.32 |
COG5646 | Iron-binding protein Fra/YdhG, frataxin family (Fe-S cluster biosynthesis) | Posttranslational modification, protein turnover, chaperones [O] | 0.32 |
COG5649 | Uncharacterized conserved protein, DUF1801 domain | Function unknown [S] | 0.32 |
COG0025 | NhaP-type Na+/H+ or K+/H+ antiporter | Inorganic ion transport and metabolism [P] | 0.32 |
COG0042 | tRNA-dihydrouridine synthase | Translation, ribosomal structure and biogenesis [J] | 0.32 |
COG0053 | Divalent metal cation (Fe/Co/Zn/Cd) efflux pump | Inorganic ion transport and metabolism [P] | 0.32 |
COG0075 | Archaeal aspartate aminotransferase or a related aminotransferase, includes purine catabolism protein PucG | Amino acid transport and metabolism [E] | 0.32 |
COG0156 | 7-keto-8-aminopelargonate synthetase or related enzyme | Coenzyme transport and metabolism [H] | 0.32 |
COG0399 | dTDP-4-amino-4,6-dideoxygalactose transaminase | Cell wall/membrane/envelope biogenesis [M] | 0.32 |
COG0436 | Aspartate/methionine/tyrosine aminotransferase | Amino acid transport and metabolism [E] | 0.32 |
COG0475 | Kef-type K+ transport system, membrane component KefB | Inorganic ion transport and metabolism [P] | 0.32 |
COG0520 | Selenocysteine lyase/Cysteine desulfurase | Amino acid transport and metabolism [E] | 0.32 |
COG0574 | Phosphoenolpyruvate synthase/pyruvate phosphate dikinase | Carbohydrate transport and metabolism [G] | 0.32 |
COG0626 | Cystathionine beta-lyase/cystathionine gamma-synthase | Amino acid transport and metabolism [E] | 0.32 |
COG0863 | DNA modification methylase | Replication, recombination and repair [L] | 0.32 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 54.43 % |
All Organisms | root | All Organisms | 45.57 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2088090009|LWAnN_F624WLL02I45FL | Not Available | 504 | Open in IMG/M |
2124908032|Perma_A_C_ConsensusfromContig90346 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 3954 | Open in IMG/M |
3300001213|JGIcombinedJ13530_102557803 | Not Available | 750 | Open in IMG/M |
3300001213|JGIcombinedJ13530_105025076 | Not Available | 580 | Open in IMG/M |
3300001380|JGI1356J14229_10021923 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 3891 | Open in IMG/M |
3300002071|JGIcombinedJ21915_10041085 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_16_69_14 | 2046 | Open in IMG/M |
3300002549|JGI24130J36418_10025569 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1764 | Open in IMG/M |
3300002549|JGI24130J36418_10060476 | All Organisms → cellular organisms → Bacteria | 953 | Open in IMG/M |
3300002564|JGI24134J36421_10154859 | Not Available | 502 | Open in IMG/M |
3300003321|soilH1_10281528 | All Organisms → cellular organisms → Bacteria | 2264 | Open in IMG/M |
3300003461|P42013CM_1030080 | All Organisms → cellular organisms → Bacteria | 1322 | Open in IMG/M |
3300003852|Ga0031655_10019512 | All Organisms → cellular organisms → Bacteria | 3276 | Open in IMG/M |
3300003858|Ga0031656_10304353 | Not Available | 538 | Open in IMG/M |
3300003993|Ga0055468_10056108 | Not Available | 1016 | Open in IMG/M |
3300003995|Ga0055438_10012161 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1790 | Open in IMG/M |
3300003998|Ga0055472_10235820 | Not Available | 574 | Open in IMG/M |
3300003999|Ga0055469_10031299 | All Organisms → cellular organisms → Bacteria | 1300 | Open in IMG/M |
3300004004|Ga0055451_10162139 | All Organisms → cellular organisms → Bacteria | 908 | Open in IMG/M |
3300004012|Ga0055464_10131470 | All Organisms → cellular organisms → Bacteria | 714 | Open in IMG/M |
3300004015|Ga0055462_10112365 | Not Available | 806 | Open in IMG/M |
3300004019|Ga0055439_10269997 | Not Available | 558 | Open in IMG/M |
3300004022|Ga0055432_10006852 | All Organisms → cellular organisms → Bacteria | 1996 | Open in IMG/M |
3300004025|Ga0055433_10058143 | All Organisms → cellular organisms → Bacteria | 802 | Open in IMG/M |
3300004063|Ga0055483_10211780 | Not Available | 631 | Open in IMG/M |
3300004067|Ga0055485_10077896 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium CSP1-4 | 809 | Open in IMG/M |
3300004072|Ga0055512_10128704 | Not Available | 540 | Open in IMG/M |
3300004076|Ga0055522_10014271 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1281 | Open in IMG/M |
3300004114|Ga0062593_101476727 | All Organisms → cellular organisms → Bacteria | 731 | Open in IMG/M |
3300004155|Ga0066600_10080173 | All Organisms → cellular organisms → Bacteria | 1232 | Open in IMG/M |
3300004156|Ga0062589_100704397 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 897 | Open in IMG/M |
3300004463|Ga0063356_100492887 | Not Available | 1617 | Open in IMG/M |
3300004481|Ga0069718_10037078 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3973 | Open in IMG/M |
3300004481|Ga0069718_10134462 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 6206 | Open in IMG/M |
3300004481|Ga0069718_16026129 | Not Available | 1012 | Open in IMG/M |
3300004481|Ga0069718_16254953 | All Organisms → cellular organisms → Bacteria | 10435 | Open in IMG/M |
3300004778|Ga0062383_10124348 | Not Available | 1130 | Open in IMG/M |
3300004778|Ga0062383_10495065 | Not Available | 612 | Open in IMG/M |
3300004778|Ga0062383_10531657 | Not Available | 591 | Open in IMG/M |
3300005183|Ga0068993_10410181 | Not Available | 501 | Open in IMG/M |
3300005343|Ga0070687_100514966 | All Organisms → cellular organisms → Bacteria | 808 | Open in IMG/M |
3300005456|Ga0070678_101932912 | Not Available | 557 | Open in IMG/M |
3300005458|Ga0070681_10553486 | Not Available | 1064 | Open in IMG/M |
3300005487|Ga0074211_143978 | Not Available | 958 | Open in IMG/M |
3300005487|Ga0074211_144395 | Not Available | 741 | Open in IMG/M |
3300005537|Ga0070730_10093636 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 2087 | Open in IMG/M |
3300005833|Ga0074472_10774793 | Not Available | 724 | Open in IMG/M |
3300005836|Ga0074470_10154332 | Not Available | 755 | Open in IMG/M |
3300005836|Ga0074470_10199612 | Not Available | 1520 | Open in IMG/M |
3300005836|Ga0074470_10229867 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 52327 | Open in IMG/M |
3300005836|Ga0074470_11786831 | Not Available | 3397 | Open in IMG/M |
3300005841|Ga0068863_101435391 | All Organisms → cellular organisms → Bacteria | 698 | Open in IMG/M |
3300005980|Ga0066798_10182992 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 574 | Open in IMG/M |
3300006055|Ga0097691_1077727 | Not Available | 1034 | Open in IMG/M |
3300006057|Ga0075026_100828831 | Not Available | 563 | Open in IMG/M |
3300006806|Ga0079220_12152309 | Not Available | 500 | Open in IMG/M |
3300006917|Ga0075472_10617074 | Not Available | 544 | Open in IMG/M |
3300006949|Ga0075528_10202860 | Not Available | 538 | Open in IMG/M |
3300006950|Ga0075524_10375035 | Not Available | 627 | Open in IMG/M |
3300006954|Ga0079219_10048088 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1819 | Open in IMG/M |
3300007521|Ga0105044_10757960 | Not Available | 779 | Open in IMG/M |
3300007775|Ga0102953_1331114 | Not Available | 641 | Open in IMG/M |
3300007799|Ga0105049_11154852 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 506 | Open in IMG/M |
3300009029|Ga0066793_10291774 | Not Available | 943 | Open in IMG/M |
3300009029|Ga0066793_10408507 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 779 | Open in IMG/M |
3300009029|Ga0066793_10422830 | Not Available | 764 | Open in IMG/M |
3300009029|Ga0066793_10879589 | Not Available | 507 | Open in IMG/M |
3300009053|Ga0105095_10190321 | Not Available | 1124 | Open in IMG/M |
3300009078|Ga0105106_10513999 | Not Available | 861 | Open in IMG/M |
3300009078|Ga0105106_11032539 | All Organisms → cellular organisms → Bacteria | 584 | Open in IMG/M |
3300009083|Ga0105047_10037457 | All Organisms → cellular organisms → Bacteria | 6992 | Open in IMG/M |
3300009085|Ga0105103_10495566 | Not Available | 685 | Open in IMG/M |
3300009087|Ga0105107_10325850 | Not Available | 1070 | Open in IMG/M |
3300009087|Ga0105107_10577449 | All Organisms → cellular organisms → Bacteria | 783 | Open in IMG/M |
3300009091|Ga0102851_11127199 | Not Available | 860 | Open in IMG/M |
3300009153|Ga0105094_10122086 | Not Available | 1477 | Open in IMG/M |
3300009165|Ga0105102_10705292 | Not Available | 567 | Open in IMG/M |
3300009169|Ga0105097_10551452 | Not Available | 647 | Open in IMG/M |
3300009868|Ga0130016_10022291 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 8499 | Open in IMG/M |
3300009870|Ga0131092_10105018 | All Organisms → cellular organisms → Bacteria | 3309 | Open in IMG/M |
3300009870|Ga0131092_10153844 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 2522 | Open in IMG/M |
3300009870|Ga0131092_10197314 | All Organisms → cellular organisms → Bacteria | 2109 | Open in IMG/M |
3300009870|Ga0131092_10224127 | All Organisms → cellular organisms → Bacteria | 2721 | Open in IMG/M |
3300009870|Ga0131092_10746872 | Not Available | 826 | Open in IMG/M |
3300009873|Ga0131077_10312319 | All Organisms → cellular organisms → Bacteria | 1554 | Open in IMG/M |
3300010044|Ga0126310_10031957 | All Organisms → cellular organisms → Bacteria | 2771 | Open in IMG/M |
3300010166|Ga0126306_10369800 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1117 | Open in IMG/M |
3300010391|Ga0136847_13036561 | All Organisms → cellular organisms → Bacteria | 988 | Open in IMG/M |
3300011267|Ga0151621_1348594 | Not Available | 817 | Open in IMG/M |
3300012092|Ga0136621_1355025 | Not Available | 568 | Open in IMG/M |
3300012668|Ga0157216_10023660 | Not Available | 3188 | Open in IMG/M |
3300012668|Ga0157216_10023660 | Not Available | 3188 | Open in IMG/M |
3300012670|Ga0137335_1028198 | Not Available | 544 | Open in IMG/M |
3300012680|Ga0136612_10471701 | Not Available | 637 | Open in IMG/M |
3300012910|Ga0157308_10102408 | Not Available | 847 | Open in IMG/M |
3300012964|Ga0153916_10497554 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1289 | Open in IMG/M |
3300012981|Ga0168316_110180 | Not Available | 1680 | Open in IMG/M |
3300012985|Ga0164308_10927619 | Not Available | 769 | Open in IMG/M |
3300013232|Ga0170573_10493538 | Not Available | 876 | Open in IMG/M |
3300013315|Ga0173609_10124904 | Not Available | 1966 | Open in IMG/M |
3300013315|Ga0173609_10291195 | Not Available | 685 | Open in IMG/M |
3300014264|Ga0075308_1029042 | All Organisms → cellular organisms → Bacteria | 1016 | Open in IMG/M |
3300014265|Ga0075314_1140011 | Not Available | 554 | Open in IMG/M |
3300014296|Ga0075344_1071834 | Not Available | 661 | Open in IMG/M |
3300014298|Ga0075341_1077063 | Not Available | 612 | Open in IMG/M |
3300014298|Ga0075341_1121111 | Not Available | 532 | Open in IMG/M |
3300014299|Ga0075303_1108805 | Not Available | 548 | Open in IMG/M |
3300014304|Ga0075340_1008969 | All Organisms → cellular organisms → Bacteria | 1321 | Open in IMG/M |
3300014304|Ga0075340_1083073 | Not Available | 618 | Open in IMG/M |
3300014315|Ga0075350_1182472 | Not Available | 546 | Open in IMG/M |
3300014318|Ga0075351_1106686 | Not Available | 612 | Open in IMG/M |
3300014321|Ga0075353_1009939 | Not Available | 1544 | Open in IMG/M |
3300014324|Ga0075352_1031119 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1177 | Open in IMG/M |
3300014490|Ga0182010_10130633 | Not Available | 1281 | Open in IMG/M |
3300014496|Ga0182011_10191434 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1395 | Open in IMG/M |
3300014496|Ga0182011_10688661 | Not Available | 645 | Open in IMG/M |
3300014498|Ga0182019_10264490 | Not Available | 1136 | Open in IMG/M |
3300014502|Ga0182021_10703503 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1212 | Open in IMG/M |
3300014502|Ga0182021_11207935 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 911 | Open in IMG/M |
3300014502|Ga0182021_11902430 | Not Available | 716 | Open in IMG/M |
3300014839|Ga0182027_11256573 | Not Available | 741 | Open in IMG/M |
3300014874|Ga0180084_1059248 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_16_70_13 | 770 | Open in IMG/M |
3300014969|Ga0157376_11958985 | Not Available | 623 | Open in IMG/M |
3300015191|Ga0167659_1086399 | Not Available | 543 | Open in IMG/M |
3300015199|Ga0167647_1006456 | All Organisms → cellular organisms → Bacteria | 3820 | Open in IMG/M |
3300015199|Ga0167647_1029601 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1613 | Open in IMG/M |
3300015208|Ga0167664_1000195 | All Organisms → cellular organisms → Bacteria | 29522 | Open in IMG/M |
3300015208|Ga0167664_1037150 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1653 | Open in IMG/M |
3300015250|Ga0180072_1102616 | Not Available | 510 | Open in IMG/M |
3300015360|Ga0163144_10994787 | Not Available | 804 | Open in IMG/M |
3300015372|Ga0132256_101769430 | Not Available | 726 | Open in IMG/M |
3300017787|Ga0183260_10246122 | Not Available | 1235 | Open in IMG/M |
3300018055|Ga0184616_10341733 | Not Available | 564 | Open in IMG/M |
3300018465|Ga0190269_10040261 | Not Available | 2140 | Open in IMG/M |
3300018465|Ga0190269_11547004 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 549 | Open in IMG/M |
3300018481|Ga0190271_13831435 | Not Available | 503 | Open in IMG/M |
3300020057|Ga0163151_10392482 | Not Available | 710 | Open in IMG/M |
3300020163|Ga0194039_1094254 | Not Available | 1067 | Open in IMG/M |
3300020186|Ga0163153_10109523 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1616 | Open in IMG/M |
3300020186|Ga0163153_10134936 | All Organisms → cellular organisms → Bacteria | 1378 | Open in IMG/M |
3300020214|Ga0194132_10479786 | Not Available | 618 | Open in IMG/M |
3300021081|Ga0210379_10079375 | Not Available | 1346 | Open in IMG/M |
3300021329|Ga0210362_1267355 | Not Available | 608 | Open in IMG/M |
3300021332|Ga0210339_1102608 | Not Available | 784 | Open in IMG/M |
3300021332|Ga0210339_1605932 | Not Available | 628 | Open in IMG/M |
3300022209|Ga0224497_10003470 | All Organisms → cellular organisms → Bacteria | 8824 | Open in IMG/M |
3300022213|Ga0224500_10009451 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → unclassified Thermomicrobiales → Thermomicrobiales bacterium | 4483 | Open in IMG/M |
3300022213|Ga0224500_10078833 | Not Available | 1275 | Open in IMG/M |
3300022214|Ga0224505_10008525 | All Organisms → cellular organisms → Bacteria | 5086 | Open in IMG/M |
3300022214|Ga0224505_10029282 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium CSP1-4 | 2398 | Open in IMG/M |
3300025155|Ga0209320_10351763 | Not Available | 602 | Open in IMG/M |
3300025159|Ga0209619_10026549 | All Organisms → cellular organisms → Bacteria | 3781 | Open in IMG/M |
3300025160|Ga0209109_10457456 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 586 | Open in IMG/M |
3300025174|Ga0209324_10148572 | Not Available | 1590 | Open in IMG/M |
3300025309|Ga0209212_1005297 | All Organisms → cellular organisms → Bacteria | 15454 | Open in IMG/M |
3300025318|Ga0209519_10349982 | Not Available | 851 | Open in IMG/M |
3300025481|Ga0208079_1101559 | Not Available | 525 | Open in IMG/M |
3300025484|Ga0208587_1070770 | Not Available | 756 | Open in IMG/M |
3300025493|Ga0208610_118460 | Not Available | 625 | Open in IMG/M |
3300025515|Ga0208733_125742 | Not Available | 520 | Open in IMG/M |
3300025521|Ga0210083_1019750 | All Organisms → cellular organisms → Bacteria | 938 | Open in IMG/M |
3300025559|Ga0210087_1070764 | Not Available | 692 | Open in IMG/M |
3300025573|Ga0210133_1102082 | Not Available | 633 | Open in IMG/M |
3300025580|Ga0210138_1002117 | All Organisms → cellular organisms → Bacteria | 3597 | Open in IMG/M |
3300025580|Ga0210138_1006317 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 2213 | Open in IMG/M |
3300025692|Ga0209744_1086854 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1096 | Open in IMG/M |
3300025739|Ga0209745_1036641 | All Organisms → cellular organisms → Bacteria | 1924 | Open in IMG/M |
3300025750|Ga0209747_1011230 | All Organisms → cellular organisms → Bacteria | 3913 | Open in IMG/M |
3300025846|Ga0209538_1145916 | Not Available | 919 | Open in IMG/M |
3300025846|Ga0209538_1212491 | Not Available | 716 | Open in IMG/M |
3300025857|Ga0209014_10194906 | Not Available | 706 | Open in IMG/M |
3300025865|Ga0209226_10114584 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1221 | Open in IMG/M |
3300025865|Ga0209226_10278541 | Not Available | 709 | Open in IMG/M |
3300025912|Ga0207707_11152602 | Not Available | 629 | Open in IMG/M |
3300025946|Ga0210126_104557 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1128 | Open in IMG/M |
3300025952|Ga0210077_1088214 | Not Available | 644 | Open in IMG/M |
3300026048|Ga0208915_1014934 | Not Available | 680 | Open in IMG/M |
3300027703|Ga0207862_1207140 | Not Available | 581 | Open in IMG/M |
3300027819|Ga0209514_10000618 | All Organisms → cellular organisms → Bacteria | 70336 | Open in IMG/M |
3300027831|Ga0209797_10107800 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1212 | Open in IMG/M |
3300027841|Ga0209262_10167263 | All Organisms → cellular organisms → Bacteria | 1058 | Open in IMG/M |
3300027843|Ga0209798_10123492 | Not Available | 1308 | Open in IMG/M |
3300027857|Ga0209166_10229125 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 991 | Open in IMG/M |
3300027885|Ga0209450_10095998 | Not Available | 1954 | Open in IMG/M |
3300027887|Ga0208980_10219940 | Not Available | 1107 | Open in IMG/M |
3300027896|Ga0209777_10014565 | All Organisms → cellular organisms → Bacteria | 8040 | Open in IMG/M |
3300027896|Ga0209777_10022357 | All Organisms → cellular organisms → Bacteria | 6208 | Open in IMG/M |
3300027896|Ga0209777_10029204 | All Organisms → cellular organisms → Bacteria | 5274 | Open in IMG/M |
3300027896|Ga0209777_10044988 | Not Available | 4040 | Open in IMG/M |
3300027896|Ga0209777_10489608 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium CSP1-4 | 909 | Open in IMG/M |
3300027896|Ga0209777_10705565 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 717 | Open in IMG/M |
3300027896|Ga0209777_10715470 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 711 | Open in IMG/M |
3300027897|Ga0209254_10020400 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae | 6041 | Open in IMG/M |
3300027897|Ga0209254_10032357 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4679 | Open in IMG/M |
3300027897|Ga0209254_10071575 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Saccharomonospora → Saccharomonospora marina → Saccharomonospora marina XMU15 | 2966 | Open in IMG/M |
3300027897|Ga0209254_10093352 | All Organisms → cellular organisms → Bacteria | 2537 | Open in IMG/M |
3300027900|Ga0209253_10286402 | Not Available | 1284 | Open in IMG/M |
3300027900|Ga0209253_10340093 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1155 | Open in IMG/M |
3300027902|Ga0209048_10233417 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces → Streptomyces sp. RKAG293 | 1320 | Open in IMG/M |
3300027902|Ga0209048_10318009 | Not Available | 1086 | Open in IMG/M |
3300027902|Ga0209048_10999452 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 534 | Open in IMG/M |
3300028803|Ga0307281_10058532 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → unclassified Dehalococcoidia → Dehalococcoidia bacterium | 1226 | Open in IMG/M |
3300028865|Ga0302291_10211823 | Not Available | 661 | Open in IMG/M |
3300028868|Ga0302163_10031260 | All Organisms → cellular organisms → Bacteria | 1203 | Open in IMG/M |
3300030006|Ga0299907_10220023 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1564 | Open in IMG/M |
3300030010|Ga0302299_10128886 | Not Available | 1382 | Open in IMG/M |
3300030010|Ga0302299_10292742 | Not Available | 849 | Open in IMG/M |
3300030047|Ga0302286_10504660 | Not Available | 613 | Open in IMG/M |
3300030114|Ga0311333_10023755 | Not Available | 4224 | Open in IMG/M |
3300030294|Ga0311349_10713241 | Not Available | 946 | Open in IMG/M |
3300030620|Ga0302046_10087311 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2538 | Open in IMG/M |
3300031229|Ga0299913_10720857 | All Organisms → cellular organisms → Bacteria | 974 | Open in IMG/M |
3300031232|Ga0302323_100716979 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Acrocarpospora | 1094 | Open in IMG/M |
3300031232|Ga0302323_102618043 | Not Available | 576 | Open in IMG/M |
3300031232|Ga0302323_103058973 | Not Available | 533 | Open in IMG/M |
3300031256|Ga0315556_1003532 | All Organisms → cellular organisms → Bacteria | 8562 | Open in IMG/M |
3300031341|Ga0307418_1001783 | Not Available | 6802 | Open in IMG/M |
3300031450|Ga0272433_10029431 | All Organisms → cellular organisms → Bacteria | 4664 | Open in IMG/M |
3300031521|Ga0311364_10019437 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 7500 | Open in IMG/M |
3300031539|Ga0307380_10036313 | All Organisms → cellular organisms → Bacteria | 5620 | Open in IMG/M |
3300031539|Ga0307380_10303238 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1481 | Open in IMG/M |
3300031539|Ga0307380_10306439 | Not Available | 1471 | Open in IMG/M |
3300031539|Ga0307380_10739303 | Not Available | 822 | Open in IMG/M |
3300031565|Ga0307379_10025367 | All Organisms → cellular organisms → Bacteria | 7246 | Open in IMG/M |
3300031565|Ga0307379_10843814 | Not Available | 801 | Open in IMG/M |
3300031565|Ga0307379_11537807 | Not Available | 528 | Open in IMG/M |
3300031576|Ga0247727_10038443 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 6269 | Open in IMG/M |
3300031699|Ga0315535_1344334 | Not Available | 502 | Open in IMG/M |
3300031707|Ga0315291_11482519 | Not Available | 535 | Open in IMG/M |
3300031727|Ga0316576_10862186 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 650 | Open in IMG/M |
3300031746|Ga0315293_10102935 | All Organisms → cellular organisms → Bacteria | 2422 | Open in IMG/M |
3300031746|Ga0315293_10111026 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_16_70_13 | 2318 | Open in IMG/M |
3300031746|Ga0315293_10647976 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 793 | Open in IMG/M |
3300031772|Ga0315288_10081638 | Not Available | 3747 | Open in IMG/M |
3300031772|Ga0315288_10091615 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 3498 | Open in IMG/M |
3300031834|Ga0315290_10021113 | All Organisms → cellular organisms → Bacteria | 5045 | Open in IMG/M |
3300031834|Ga0315290_10107731 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Cellulomonadaceae → Cellulomonas | 2358 | Open in IMG/M |
3300031834|Ga0315290_10115462 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Kocuria → Kocuria turfanensis | 2279 | Open in IMG/M |
3300031834|Ga0315290_10810439 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 800 | Open in IMG/M |
3300031873|Ga0315297_10000667 | All Organisms → cellular organisms → Bacteria | 20204 | Open in IMG/M |
3300031873|Ga0315297_10224144 | Not Available | 1553 | Open in IMG/M |
3300031902|Ga0302322_103905322 | Not Available | 509 | Open in IMG/M |
3300031903|Ga0307407_10313592 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1098 | Open in IMG/M |
3300031918|Ga0311367_10496545 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1252 | Open in IMG/M |
3300031918|Ga0311367_10963523 | Not Available | 856 | Open in IMG/M |
3300031965|Ga0326597_10062122 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4642 | Open in IMG/M |
3300031965|Ga0326597_11158788 | All Organisms → cellular organisms → Bacteria | 767 | Open in IMG/M |
3300031965|Ga0326597_11462678 | Not Available | 658 | Open in IMG/M |
3300031997|Ga0315278_10036545 | All Organisms → cellular organisms → Bacteria | 4761 | Open in IMG/M |
3300031997|Ga0315278_10042804 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4414 | Open in IMG/M |
3300031997|Ga0315278_10057089 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3839 | Open in IMG/M |
3300031997|Ga0315278_10164820 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales | 2269 | Open in IMG/M |
3300031997|Ga0315278_10301230 | Not Available | 1656 | Open in IMG/M |
3300031997|Ga0315278_10323517 | Not Available | 1594 | Open in IMG/M |
3300031997|Ga0315278_10603465 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1123 | Open in IMG/M |
3300031997|Ga0315278_10971761 | Not Available | 847 | Open in IMG/M |
3300031997|Ga0315278_11307386 | Not Available | 706 | Open in IMG/M |
3300031997|Ga0315278_11323137 | Not Available | 701 | Open in IMG/M |
3300031997|Ga0315278_11361236 | Not Available | 689 | Open in IMG/M |
3300031997|Ga0315278_11504047 | Not Available | 647 | Open in IMG/M |
3300031997|Ga0315278_11505474 | Not Available | 647 | Open in IMG/M |
3300031997|Ga0315278_11988310 | Not Available | 543 | Open in IMG/M |
3300032018|Ga0315272_10095984 | Not Available | 1368 | Open in IMG/M |
3300032018|Ga0315272_10568794 | Not Available | 570 | Open in IMG/M |
3300032018|Ga0315272_10584954 | Not Available | 562 | Open in IMG/M |
3300032061|Ga0315540_10030378 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2663 | Open in IMG/M |
3300032061|Ga0315540_10221889 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales | 810 | Open in IMG/M |
3300032143|Ga0315292_10360186 | Not Available | 1218 | Open in IMG/M |
3300032143|Ga0315292_10395080 | Not Available | 1160 | Open in IMG/M |
3300032143|Ga0315292_10426782 | Not Available | 1114 | Open in IMG/M |
3300032143|Ga0315292_11005371 | Not Available | 692 | Open in IMG/M |
3300032156|Ga0315295_10311854 | Not Available | 1595 | Open in IMG/M |
3300032163|Ga0315281_10359672 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_2_20CM_2_71_6 | 1576 | Open in IMG/M |
3300032163|Ga0315281_10453867 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Cellulomonadaceae → Cellulomonas | 1372 | Open in IMG/M |
3300032163|Ga0315281_12164241 | Not Available | 527 | Open in IMG/M |
3300032164|Ga0315283_10974657 | Not Available | 899 | Open in IMG/M |
3300032164|Ga0315283_11022839 | Not Available | 873 | Open in IMG/M |
3300032164|Ga0315283_11483998 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium CSP1-4 | 695 | Open in IMG/M |
3300032164|Ga0315283_12044884 | Not Available | 568 | Open in IMG/M |
3300032173|Ga0315268_10009452 | All Organisms → cellular organisms → Bacteria | 10113 | Open in IMG/M |
3300032173|Ga0315268_10441380 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Kineosporiales → Kineosporiaceae → Angustibacter → unclassified Angustibacter → Angustibacter sp. Root456 | 1278 | Open in IMG/M |
3300032173|Ga0315268_11771753 | Not Available | 631 | Open in IMG/M |
3300032256|Ga0315271_10143834 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1863 | Open in IMG/M |
3300032256|Ga0315271_10636230 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 913 | Open in IMG/M |
3300032256|Ga0315271_10732338 | Not Available | 850 | Open in IMG/M |
3300032256|Ga0315271_11083014 | Not Available | 692 | Open in IMG/M |
3300032275|Ga0315270_10409137 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 866 | Open in IMG/M |
3300032275|Ga0315270_10497115 | Not Available | 786 | Open in IMG/M |
3300032275|Ga0315270_10765656 | Not Available | 634 | Open in IMG/M |
3300032275|Ga0315270_10927436 | Not Available | 576 | Open in IMG/M |
3300032275|Ga0315270_11062322 | Not Available | 537 | Open in IMG/M |
3300032342|Ga0315286_10422487 | All Organisms → cellular organisms → Bacteria | 1398 | Open in IMG/M |
3300032342|Ga0315286_12180408 | Not Available | 510 | Open in IMG/M |
3300032397|Ga0315287_10179051 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia | 2464 | Open in IMG/M |
3300032397|Ga0315287_10648069 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1249 | Open in IMG/M |
3300032397|Ga0315287_10695025 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1201 | Open in IMG/M |
3300032397|Ga0315287_11221036 | Not Available | 864 | Open in IMG/M |
3300032397|Ga0315287_12495023 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium CSP1-4 | 555 | Open in IMG/M |
3300032397|Ga0315287_12739373 | Not Available | 523 | Open in IMG/M |
3300032401|Ga0315275_12154923 | Not Available | 584 | Open in IMG/M |
3300032516|Ga0315273_11535210 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium CSP1-4 | 817 | Open in IMG/M |
3300032516|Ga0315273_12148607 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium CSP1-4 | 657 | Open in IMG/M |
3300033233|Ga0334722_10004801 | All Organisms → cellular organisms → Bacteria | 13913 | Open in IMG/M |
3300033233|Ga0334722_10021705 | All Organisms → cellular organisms → Bacteria | 5471 | Open in IMG/M |
3300033233|Ga0334722_10102832 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 2168 | Open in IMG/M |
3300033233|Ga0334722_10358031 | Not Available | 1058 | Open in IMG/M |
3300033413|Ga0316603_11156295 | Not Available | 733 | Open in IMG/M |
3300033521|Ga0316616_101886346 | Not Available | 788 | Open in IMG/M |
3300033891|Ga0334811_101013 | Not Available | 737 | Open in IMG/M |
3300034053|Ga0373890_026684 | Not Available | 853 | Open in IMG/M |
3300034054|Ga0373891_078988 | Not Available | 547 | Open in IMG/M |
3300034077|Ga0373899_006193 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1081 | Open in IMG/M |
3300034077|Ga0373899_008525 | All Organisms → cellular organisms → Bacteria | 974 | Open in IMG/M |
3300034125|Ga0370484_0012161 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1862 | Open in IMG/M |
3300034165|Ga0364942_0102450 | Not Available | 926 | Open in IMG/M |
3300034281|Ga0370481_0005631 | Not Available | 3284 | Open in IMG/M |
3300034773|Ga0364936_073437 | Not Available | 648 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 21.52% |
Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 6.96% |
Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 6.01% |
Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 5.38% |
Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 4.43% |
Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 4.11% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.48% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 2.85% |
Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 2.53% |
Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 2.22% |
Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 2.22% |
Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 1.58% |
Sediment | Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment | 1.58% |
Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 1.58% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.58% |
Activated Sludge | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge | 1.58% |
Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment | 1.27% |
Freshwater Microbial Mat | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Microbial Mat | 1.27% |
Salt Marsh Sediment | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh Sediment | 1.27% |
Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 1.27% |
Sediment Slurry | Engineered → Bioremediation → Metal → Unclassified → Unclassified → Sediment Slurry | 1.27% |
Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 0.95% |
Freshwater | Environmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater | 0.95% |
Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 0.95% |
Wetland | Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland | 0.95% |
Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.95% |
Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Sediment | 0.63% |
Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater | 0.63% |
Freshwater | Environmental → Aquatic → Freshwater → Pond → Sediment → Freshwater | 0.63% |
Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.63% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.63% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.63% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.63% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.63% |
Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.63% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.63% |
Serpentinite Rock And Fluid | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Serpentinite Rock And Fluid | 0.63% |
Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.63% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.63% |
Wastewater | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Wastewater | 0.63% |
Sediment | Engineered → Wastewater → Industrial Wastewater → Mine Water → Unclassified → Sediment | 0.63% |
Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.32% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Sediment | 0.32% |
Anoxic Zone Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater | 0.32% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.32% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Sediment | 0.32% |
Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.32% |
Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.32% |
Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.32% |
Sediment | Environmental → Aquatic → Freshwater → Groundwater → Acid Mine Drainage → Sediment | 0.32% |
Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 0.32% |
Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 0.32% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.32% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.32% |
Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 0.32% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Soil | 0.32% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.32% |
Ore Pile And Mine Drainage Contaminated Soil | Environmental → Terrestrial → Soil → Unclassified → Mine Drainage → Ore Pile And Mine Drainage Contaminated Soil | 0.32% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.32% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.32% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.32% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.32% |
Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.32% |
Rock | Environmental → Terrestrial → Rock-Dwelling (Endoliths) → Unclassified → Unclassified → Rock | 0.32% |
Biofilm | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm | 0.32% |
Weathered Mine Tailings | Environmental → Terrestrial → Geologic → Mine → Unclassified → Weathered Mine Tailings | 0.32% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.32% |
Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.32% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.32% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.32% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.32% |
Sediment | Engineered → Wastewater → Industrial Wastewater → Mine Water → Unclassified → Sediment | 0.32% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2088090009 | Freshwater sediment microbial communities from Lake Washington, Seattle, for methane and nitrogen Cycles - SIP 13C-methane anaerobic+nitrate | Environmental | Open in IMG/M |
2124908032 | Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Perma_all | Environmental | Open in IMG/M |
3300001213 | Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly) | Environmental | Open in IMG/M |
3300001380 | Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW37 contaminated, 5.8 m | Environmental | Open in IMG/M |
3300002071 | Barrow Graham LP Ref core NGADG0011-312 (Barrow Graham LP Ref core NGADG0011-312,NGADG0011-212, ASSEMBLY_DATE=20131010) | Environmental | Open in IMG/M |
3300002549 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0002-212 | Environmental | Open in IMG/M |
3300002564 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0004-312 | Environmental | Open in IMG/M |
3300003321 | Sugarcane bulk soil Sample H1 | Environmental | Open in IMG/M |
3300003461 | Ore pile and mine drainage contaminated soil microbial communities from Mina do Sossego, Brazil - P4 sample | Environmental | Open in IMG/M |
3300003852 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies -HBP12 HB | Environmental | Open in IMG/M |
3300003858 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - DIP11 DI | Environmental | Open in IMG/M |
3300003993 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailC_D2 | Environmental | Open in IMG/M |
3300003995 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleA_D2 | Environmental | Open in IMG/M |
3300003998 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleC_D2 | Environmental | Open in IMG/M |
3300003999 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleA_D2 | Environmental | Open in IMG/M |
3300004004 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - China_Galinas_PWB_D2 | Environmental | Open in IMG/M |
3300004012 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_ThreeSqC_D2 | Environmental | Open in IMG/M |
3300004015 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_ThreeSqC_D1 | Environmental | Open in IMG/M |
3300004019 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleB_D2 | Environmental | Open in IMG/M |
3300004022 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqA_D1 | Environmental | Open in IMG/M |
3300004025 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqB_D1 | Environmental | Open in IMG/M |
3300004063 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_CattailNLB_D2 | Environmental | Open in IMG/M |
3300004067 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_ThreeSqA_D2 | Environmental | Open in IMG/M |
3300004072 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - WestPond_TuleA_D2 | Environmental | Open in IMG/M |
3300004076 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - White_ThreeSqB_D2 | Environmental | Open in IMG/M |
3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
3300004155 | Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - Low cellulose week 11 | Environmental | Open in IMG/M |
3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
3300004481 | Combined Assembly of Gp0112041, Gp0112042, Gp0112043 | Environmental | Open in IMG/M |
3300004778 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare3Fresh | Environmental | Open in IMG/M |
3300005183 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqC_D1 | Environmental | Open in IMG/M |
3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Environmental | Open in IMG/M |
3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Host-Associated | Open in IMG/M |
3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
3300005487 | Sediment microbial communities from Lake Washington, Seattle, Washington, USA - Methanol enrichment | Environmental | Open in IMG/M |
3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
3300005833 | Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.174_CBK | Environmental | Open in IMG/M |
3300005836 | Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.42_YBB | Environmental | Open in IMG/M |
3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
3300005980 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil leachate replicate DNA2013-203 | Environmental | Open in IMG/M |
3300006055 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-1 deep-072012 | Environmental | Open in IMG/M |
3300006057 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012 | Environmental | Open in IMG/M |
3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
3300006917 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_<0.8_DNA | Environmental | Open in IMG/M |
3300006949 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost159B-16B | Environmental | Open in IMG/M |
3300006950 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost154B-one | Environmental | Open in IMG/M |
3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
3300007521 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-01 | Environmental | Open in IMG/M |
3300007775 | Soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_C_D2_MG | Environmental | Open in IMG/M |
3300007799 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-06 | Environmental | Open in IMG/M |
3300009029 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 1 DNA2013-189 | Environmental | Open in IMG/M |
3300009053 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 19-21cm March2015 | Environmental | Open in IMG/M |
3300009078 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm September2015 | Environmental | Open in IMG/M |
3300009083 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-04 (megahit assembly) | Environmental | Open in IMG/M |
3300009085 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015 | Environmental | Open in IMG/M |
3300009087 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm September2015 | Environmental | Open in IMG/M |
3300009091 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
3300009153 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 10-12cm March2015 | Environmental | Open in IMG/M |
3300009165 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
3300009169 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 | Environmental | Open in IMG/M |
3300009868 | Activated sludge microbial diversity in wastewater treatment plant from Tai Wan - Bali plant Bali plant | Engineered | Open in IMG/M |
3300009870 | Activated sludge microbial diversity in wastewater treatment plant from Taiwan - Linkou plant | Engineered | Open in IMG/M |
3300009873 | Activated sludge microbial diversity in wastewater treatment plant from Taiwan - Wenshan plant | Engineered | Open in IMG/M |
3300010044 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60 | Environmental | Open in IMG/M |
3300010166 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27 | Environmental | Open in IMG/M |
3300010391 | Freshwater sediment microbial communities from Lake Superior, USA - Station SU-17. Combined Assembly of Gp0155404, Gp0155335, Gp0155336, Gp0155336, Gp0155403, Gp0155406 | Environmental | Open in IMG/M |
3300011267 | Acid mine drainage microbial communities from Malanjkhand copper mine, India - M16 k-mer-51 | Environmental | Open in IMG/M |
3300012092 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ445A (23.06) | Environmental | Open in IMG/M |
3300012668 | Arctic soils microbial communities. Combined Assembly of 23 SPs | Environmental | Open in IMG/M |
3300012670 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT293_2 | Environmental | Open in IMG/M |
3300012680 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ224A (23.06) | Environmental | Open in IMG/M |
3300012910 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S198-509B-2 | Environmental | Open in IMG/M |
3300012964 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 4 metaG | Environmental | Open in IMG/M |
3300012981 | Weathered mine tailings microbial communities from Hibbing, Minnesota, USA - DT8 | Environmental | Open in IMG/M |
3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
3300013232 | Sediment microbial communities from Acid Mine Drainage holding pond in Pittsburgh, PA, USA ? S1 | Engineered | Open in IMG/M |
3300013315 | Sediment microbial communities from Acid Mine Drainage holding pond in Pittsburgh, PA, USA - 1B | Engineered | Open in IMG/M |
3300014264 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_ThreeSqA_D2_rd | Environmental | Open in IMG/M |
3300014265 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailC_D2 | Environmental | Open in IMG/M |
3300014296 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqC_D1 | Environmental | Open in IMG/M |
3300014298 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_ThreeSqB_D1 | Environmental | Open in IMG/M |
3300014299 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleC_D1 | Environmental | Open in IMG/M |
3300014304 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_ThreeSqA_D1 | Environmental | Open in IMG/M |
3300014315 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_TuleC_D1 | Environmental | Open in IMG/M |
3300014318 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqA_D1_rd | Environmental | Open in IMG/M |
3300014321 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleB_D1 | Environmental | Open in IMG/M |
3300014324 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleA_D1 | Environmental | Open in IMG/M |
3300014490 | Permafrost microbial communities from Stordalen Mire, Sweden - 611E1M metaG | Environmental | Open in IMG/M |
3300014496 | Permafrost microbial communities from Stordalen Mire, Sweden - 711E1D metaG | Environmental | Open in IMG/M |
3300014498 | Permafrost microbial communities from Stordalen Mire, Sweden - 812E2M metaG | Environmental | Open in IMG/M |
3300014502 | Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
3300014839 | Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (Illumina Assembly) | Environmental | Open in IMG/M |
3300014874 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT660_2_16_10D | Environmental | Open in IMG/M |
3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
3300015191 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-10 : a,b,c samples pooled, hydrological sediment from glacier outflow) | Environmental | Open in IMG/M |
3300015199 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-2c, rock/snow interface) | Environmental | Open in IMG/M |
3300015208 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Samples st-15,16,16 pooled, 1st-3rd transect points, snow/rock/ice interface) | Environmental | Open in IMG/M |
3300015250 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT293B_16_10D | Environmental | Open in IMG/M |
3300015360 | Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica - Oligotrophic Lake LV.19.BULKMAT1 | Environmental | Open in IMG/M |
3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
3300017787 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ497 (22.06) (version 2) | Environmental | Open in IMG/M |
3300018055 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_90_coex | Environmental | Open in IMG/M |
3300018465 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 IS | Environmental | Open in IMG/M |
3300018481 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T | Environmental | Open in IMG/M |
3300020057 | Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica - Oligotrophic Lake LV.19.MP5.IB-2 | Environmental | Open in IMG/M |
3300020163 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L227-8m | Environmental | Open in IMG/M |
3300020186 | Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica - Oligotrophic Lake LV.19.MP6.IB-1 | Environmental | Open in IMG/M |
3300020214 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015054 Kigoma Offshore 80m | Environmental | Open in IMG/M |
3300021081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_coex redo | Environmental | Open in IMG/M |
3300021329 | Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Oregon, United States ? S.625 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300021332 | Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Oregon, United States ? S.384 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300022209 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Jul11_sed_USGS_13 | Environmental | Open in IMG/M |
3300022213 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Oct11_sed_USGS_4_1 | Environmental | Open in IMG/M |
3300022214 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Jan12_sed_USGS_4_1 | Environmental | Open in IMG/M |
3300025155 | Soil microbial communities from Rifle, Colorado, USA - sediment 13ft 4 | Environmental | Open in IMG/M |
3300025159 | Soil microbial communities from Rifle, Colorado, USA - sediment 16ft 3 | Environmental | Open in IMG/M |
3300025160 | Soil microbial communities from Rifle, Colorado, USA - sediment 10ft 2 | Environmental | Open in IMG/M |
3300025174 | Soil microbial communities from Rifle, Colorado, USA - sediment 19ft 3 | Environmental | Open in IMG/M |
3300025309 | Soil microbial communities from Rifle, Colorado, USA - Groundwater C2 | Environmental | Open in IMG/M |
3300025318 | Soil microbial communities from Rifle, Colorado, USA - sediment 13ft 1 | Environmental | Open in IMG/M |
3300025481 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-2 deep-092012 (SPAdes) | Environmental | Open in IMG/M |
3300025484 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210 deep-092012 (SPAdes) | Environmental | Open in IMG/M |
3300025493 | Serpentinite rock and fluid subsurface biosphere microbial communities from McLaughlin Reserve, California, USA - CR11Jul_8A2 (SPAdes) | Environmental | Open in IMG/M |
3300025515 | Serpentinite rock and fluid subsurface biosphere microbial communities from McLaughlin Reserve, California, USA - CR11Jul_8B1 (SPAdes) | Environmental | Open in IMG/M |
3300025521 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqB_D1 (SPAdes) | Environmental | Open in IMG/M |
3300025559 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailB_D2 (SPAdes) | Environmental | Open in IMG/M |
3300025573 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_ThreeSqC_D1 (SPAdes) | Environmental | Open in IMG/M |
3300025580 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqC_D1 (SPAdes) | Environmental | Open in IMG/M |
3300025692 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0004-311 (SPAdes) | Environmental | Open in IMG/M |
3300025739 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0004-312 (SPAdes) | Environmental | Open in IMG/M |
3300025750 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0011-311 (SPAdes) | Environmental | Open in IMG/M |
3300025846 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0004-211 (SPAdes) | Environmental | Open in IMG/M |
3300025857 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0002-212 (SPAdes) | Environmental | Open in IMG/M |
3300025865 | Arctic peat soil from Barrow, Alaska, USA - Barrow Graham LP Ref core NGADG0011-212 (SPAdes) | Environmental | Open in IMG/M |
3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025946 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_ThreeSqC_D2 (SPAdes) | Environmental | Open in IMG/M |
3300025952 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_CattailNLB_D2 (SPAdes) | Environmental | Open in IMG/M |
3300026048 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleB_D1 (SPAdes) | Environmental | Open in IMG/M |
3300027703 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 81 (SPAdes) | Environmental | Open in IMG/M |
3300027819 | Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW37 contaminated, 5.8 m (SPAdes) | Environmental | Open in IMG/M |
3300027831 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare3Fresh (SPAdes) | Environmental | Open in IMG/M |
3300027841 | Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - Low cellulose week 11 (SPAdes) | Environmental | Open in IMG/M |
3300027843 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare3Fresh (SPAdes) | Environmental | Open in IMG/M |
3300027857 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027885 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - LWP11 LW (SPAdes) | Environmental | Open in IMG/M |
3300027887 | Wetland microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Aug2011 Site A1 Bulk | Environmental | Open in IMG/M |
3300027896 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies -HBP12 HB (SPAdes) | Environmental | Open in IMG/M |
3300027897 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - DIP11 DI (SPAdes) | Environmental | Open in IMG/M |
3300027900 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - BRP12 BR (SPAdes) | Environmental | Open in IMG/M |
3300027902 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - CRP12 CR (SPAdes) | Environmental | Open in IMG/M |
3300028803 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_120 | Environmental | Open in IMG/M |
3300028865 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_N1_4 | Environmental | Open in IMG/M |
3300028868 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_E2_3 | Environmental | Open in IMG/M |
3300030006 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67 | Environmental | Open in IMG/M |
3300030010 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_N3_4 | Environmental | Open in IMG/M |
3300030047 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_E2_3 | Environmental | Open in IMG/M |
3300030114 | I_Fen_E2 coassembly | Environmental | Open in IMG/M |
3300030294 | II_Fen_E3 coassembly | Environmental | Open in IMG/M |
3300030620 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT147D111 | Environmental | Open in IMG/M |
3300031229 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT155D38 | Environmental | Open in IMG/M |
3300031232 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_3 | Environmental | Open in IMG/M |
3300031256 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - Salt Marsh Sediment SW1603-10 | Environmental | Open in IMG/M |
3300031341 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - WE1602-20 | Environmental | Open in IMG/M |
3300031450 | Rock endolithic microbial communities from Victoria Land, Antarctica - University Valley sud | Environmental | Open in IMG/M |
3300031521 | III_Fen_E2 coassembly | Environmental | Open in IMG/M |
3300031539 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-3 | Environmental | Open in IMG/M |
3300031565 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-2 | Environmental | Open in IMG/M |
3300031576 | Biofilm microbial communities from Wishing Well Cave, Virginia, United States - WW16-25 | Environmental | Open in IMG/M |
3300031699 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - Salt Marsh Sediment SW1602-20 | Environmental | Open in IMG/M |
3300031707 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_20 | Environmental | Open in IMG/M |
3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Host-Associated | Open in IMG/M |
3300031746 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_20 | Environmental | Open in IMG/M |
3300031772 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_20 | Environmental | Open in IMG/M |
3300031834 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_0 | Environmental | Open in IMG/M |
3300031873 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G15_0 | Environmental | Open in IMG/M |
3300031902 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_2 | Environmental | Open in IMG/M |
3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Host-Associated | Open in IMG/M |
3300031918 | III_Fen_N3 coassembly | Environmental | Open in IMG/M |
3300031965 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185 | Environmental | Open in IMG/M |
3300031997 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_0 | Environmental | Open in IMG/M |
3300032018 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_middle | Environmental | Open in IMG/M |
3300032061 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - Salt Marsh Sediment SW1601-10 | Environmental | Open in IMG/M |
3300032143 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_0 | Environmental | Open in IMG/M |
3300032156 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G14_0 | Environmental | Open in IMG/M |
3300032163 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G07_0 | Environmental | Open in IMG/M |
3300032164 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_0 | Environmental | Open in IMG/M |
3300032173 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_top | Environmental | Open in IMG/M |
3300032256 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_top | Environmental | Open in IMG/M |
3300032275 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_bottom | Environmental | Open in IMG/M |
3300032342 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G10_0 | Environmental | Open in IMG/M |
3300032397 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_0 | Environmental | Open in IMG/M |
3300032401 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G03_0 | Environmental | Open in IMG/M |
3300032516 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_0 | Environmental | Open in IMG/M |
3300033233 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_bottom | Environmental | Open in IMG/M |
3300033413 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day10_noCT | Environmental | Open in IMG/M |
3300033521 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D1_B | Environmental | Open in IMG/M |
3300033891 | Peat soil microbial communities from Stordalen Mire, Sweden - 713 E-1-D | Environmental | Open in IMG/M |
3300034053 | Uranium-contaminated sediment microbial communities from bioreactor in Oak Ridge, Tennessee, United States - A1A4.3 | Engineered | Open in IMG/M |
3300034054 | Uranium-contaminated sediment microbial communities from bioreactor in Oak Ridge, Tennessee, United States - A3A4.1 | Engineered | Open in IMG/M |
3300034077 | Uranium-contaminated sediment microbial communities from bioreactor in Oak Ridge, Tennessee, United States - A5A4.3 | Engineered | Open in IMG/M |
3300034125 | Peat soil microbial communities from wetlands in Alaska, United States - Sheep_creek_tus_01_15 | Environmental | Open in IMG/M |
3300034165 | Sediment microbial communities from East River floodplain, Colorado, United States - 19_s17 | Environmental | Open in IMG/M |
3300034281 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_03D_15 | Environmental | Open in IMG/M |
3300034773 | Sediment microbial communities from East River floodplain, Colorado, United States - 4_s17 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
LWAnN_07743660 | 2088090009 | Freshwater Sediment | VSGIELVLAFLAGVVMGGALDRFVLPLLVDVWIDRLRRHGR |
Perma_A_C_01219430 | 2124908032 | Soil | MSGVELALAFLSGVVTGVLLDRWLLPPLVDAWIDRMRRHGR |
JGIcombinedJ13530_1025578031 | 3300001213 | Wetland | MSEVGLVLAFLSGVVMSVLLDRFVLPLLVDAWIDR |
JGIcombinedJ13530_1050250762 | 3300001213 | Wetland | MNGVELVLAFLAGVVMGGTLDRFVLPLLVDAWIDR |
JGI1356J14229_100219233 | 3300001380 | Groundwater | MSEVELALAFLSGVVTGVLLDRWVLPPLVDAWIDRMRWHGR* |
JGIcombinedJ21915_100410853 | 3300002071 | Arctic Peat Soil | MSEVELAIAFFSGVVMGILLDRWVLPPLVDAWIDRLRRHGR* |
JGI24130J36418_100255692 | 3300002549 | Arctic Peat Soil | MSEVELAVAFLSGVIMGVVLDRWLLPRLVDAWIDRMRRHGQ* |
JGI24130J36418_100604762 | 3300002549 | Arctic Peat Soil | MSEVDLALAFLSGVVTGVLLDRWVLPPLVDAWIDRMRRHGQ* |
JGI24134J36421_101548591 | 3300002564 | Arctic Peat Soil | QLHGGPMSGVELGLAFLSGVVMGILLDRWLLPPLVDAWIDRMRRHGR* |
soilH1_102815283 | 3300003321 | Sugarcane Root And Bulk Soil | MNGLELVVAFLAGVLMGGALDFFVLPLLVDAWIDRRRRHER* |
P42013CM_10300803 | 3300003461 | Ore Pile And Mine Drainage Contaminated Soil | MNGLELVVAFLAGVVMGGALDFFVLPLLVDAWIDRRRRHGR* |
Ga0031655_100195124 | 3300003852 | Freshwater Lake Sediment | MSGVELALAFFSGVVLGILLDRWLLPPLVDAWIDRMRRHGR* |
Ga0031656_103043532 | 3300003858 | Freshwater Lake Sediment | MSGIELVLAFLAGVVMGGALDRFVLPLLVDAWIDRLRRHGR* |
Ga0055468_100561081 | 3300003993 | Natural And Restored Wetlands | MSGVELVLAFLAGVVMGGALDRFVLPRLVDAWIDRLRRHGR* |
Ga0055438_100121611 | 3300003995 | Natural And Restored Wetlands | MNGLELAVAFLAGVLMGGALDFFVLPLVVDAWIDRRRRHG |
Ga0055472_102358201 | 3300003998 | Natural And Restored Wetlands | MSGIELVAAFLAGVVMGGALDRFVLPLLVDAWIDRLRRHGR* |
Ga0055469_100312992 | 3300003999 | Natural And Restored Wetlands | MSGLELVLAFLAGVAMGIALDRWLLPSLVDAWIDRLRRHGR* |
Ga0055451_101621391 | 3300004004 | Natural And Restored Wetlands | MSGVELLLAFLAGVVMGGALDRFVLPLLVDAWIDRLRRHGR* |
Ga0055464_101314702 | 3300004012 | Natural And Restored Wetlands | MSGIELVAAFLAGVGMGIALDRWLLPSLVDAWIDRLRRHGR* |
Ga0055462_101123651 | 3300004015 | Natural And Restored Wetlands | MSGIVLVLAFLSGVVMGGALDRLVLPLLVDAWIDRLRRHGR* |
Ga0055439_102699973 | 3300004019 | Natural And Restored Wetlands | MSEVELVVAFLAGVVMGGALDRFVLPLLVDAWIDRLRRHGR* |
Ga0055432_100068522 | 3300004022 | Natural And Restored Wetlands | MSGVELALAFLAGVAMGIALDRVVLPMLVDAWIDRLRRHGR* |
Ga0055433_100581434 | 3300004025 | Natural And Restored Wetlands | VVELVLAFLAGVVMGGALDRWLLPLLVDAWIDRQRRHGR* |
Ga0055483_102117801 | 3300004063 | Natural And Restored Wetlands | VNGLELVAAFLAGVVMGGALDRFVLPLLVDAWIDQVRRHGR* |
Ga0055485_100778962 | 3300004067 | Natural And Restored Wetlands | MSGVELVAAFLAGVAMGIALDRWLLPPLVDAWIDRLRRHGR* |
Ga0055512_101287042 | 3300004072 | Natural And Restored Wetlands | MSGIELVAAFFAGVVMGGALDRFVLPLLVDAWIDRLRRHGR* |
Ga0055522_100142714 | 3300004076 | Natural And Restored Wetlands | MSGVELVAAFLAGVVMGGALDRFVLPLLVDAWIDRLRRHGR* |
Ga0062593_1014767272 | 3300004114 | Soil | MSEVDLAIAFLAGIVLGLVLDRLLLPPLVDAWIDRMRRHGR* |
Ga0066600_100801732 | 3300004155 | Freshwater | MSGVELVLAFLAGVVMGGALDRFVLPLLVNAWIDRLRRHGR* |
Ga0062589_1007043971 | 3300004156 | Soil | MSGFELLLAFLAGVVMGGALDRFVLPLLVDAWIDRLRRHVTRP |
Ga0063356_1004928872 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MSEVELLLAFLAGVVMGGALDRFVLPLLVDAWIDRLRRHGR* |
Ga0069718_100370789 | 3300004481 | Sediment | MTGVELVAAFLAGVVMGGALDRFVLPVLVDAWIDRLRPA* |
Ga0069718_101344625 | 3300004481 | Sediment | MSGVELALAFLAGVAMGIALDRWLLPPIVDAWIDGLRRHGR* |
Ga0069718_160261293 | 3300004481 | Sediment | MSGLELVLAFLAGVLMGGALDRFVLPLLVDAWIDRLRRHGR* |
Ga0069718_162549532 | 3300004481 | Sediment | MSGVELVAAFLAGVVMGGALDRFVLPLLVDAWIDRMRRHGR* |
Ga0062383_101243482 | 3300004778 | Wetland Sediment | MSEVELALAFLTGVVMGGALDRFVLPLLVDAWVDRLRRHGR* |
Ga0062383_104950651 | 3300004778 | Wetland Sediment | MSGLELLLAFLAGVVMGGALDRFVLPLLVDAWIDRLRRHGR* |
Ga0062383_105316571 | 3300004778 | Wetland Sediment | VSGIELVLAFLAGVAMGIALDHWLLPPLVDAWIDRLRRLG |
Ga0068993_104101812 | 3300005183 | Natural And Restored Wetlands | MSGVDLLLAFLAGVVMGGALDRFVLPLLVDAWIDRLRRHGR* |
Ga0070687_1005149661 | 3300005343 | Switchgrass Rhizosphere | MNGVELVLAFLAGVVMGGALDRFVLPLLVDAWIDRLRRHGQ* |
Ga0070678_1019329122 | 3300005456 | Miscanthus Rhizosphere | MSEVDLALAFLTGIVLGLVLDRLLLPPLVDAWIARTRRHGR* |
Ga0070681_105534861 | 3300005458 | Corn Rhizosphere | MNGLELVLAFLAGVVMGGVPDRLVVPLIVDAWIDRLRRHGR* |
Ga0074211_1439783 | 3300005487 | Sediment | MSGVELVLAFLAGVVMGGALDRFVLPLLVDAWIDRLRRHGR* |
Ga0074211_1443951 | 3300005487 | Sediment | GVELILAFLVGGVMGGALDRFVLPLLVDAWFDRLRRHGR* |
Ga0070730_100936362 | 3300005537 | Surface Soil | MSGVELVLAFLAGVAMGIALDRFVLPLLVDAWIDRLRRHER* |
Ga0074472_107747933 | 3300005833 | Sediment (Intertidal) | MNGVELILAFLAGVVMGGALDRFVLPLLVDAWIDRLRRHGR* |
Ga0074470_101543323 | 3300005836 | Sediment (Intertidal) | MSGAELVAAFLAGVVMGGALDRFVLPLLVDAWIDRLCRHGR* |
Ga0074470_101996123 | 3300005836 | Sediment (Intertidal) | MSGVELILAFLAGVVMGGALDRFVLPLLVDAWIDRLRRHGR* |
Ga0074470_102298672 | 3300005836 | Sediment (Intertidal) | MSVVELVLAFLAGVVMGGALDRWLLPLLVDAWIDRQRRHGR* |
Ga0074470_117868313 | 3300005836 | Sediment (Intertidal) | MSGLDLVLAFLAGVVMGGALDRFVLPLLVDAWLDRLRRHGR* |
Ga0068863_1014353913 | 3300005841 | Switchgrass Rhizosphere | CDRPMSEVDLAVAFLTGIVLGLVLDRLLLPPLVDAWIARSRRHGR* |
Ga0066798_101829922 | 3300005980 | Soil | MSGVELALAFLSGVVMGILLDRWLLPSLVDAWIDRMRRHGR* |
Ga0097691_10777271 | 3300006055 | Arctic Peat Soil | MSGVELALAFLSGVVMGILLDRWLLPPLVDAWIDRMRRHGR* |
Ga0075026_1008288311 | 3300006057 | Watersheds | ELALAFLAGVAMGGALDHFVLPLLVDAWIGRRRHGR* |
Ga0079220_121523091 | 3300006806 | Agricultural Soil | PMSEVELVIAFLGGVVMGGALDFFVLPLLVDAWIDRLRRHGR* |
Ga0075472_106170742 | 3300006917 | Aqueous | VELVAAFLAGVAMGGALDRFVLPLLVDAWIDRLRRHER* |
Ga0075528_102028601 | 3300006949 | Arctic Peat Soil | MSDVDLALAFLSGVATGVLLDRWVLPPLVDLWIDRMRRHGQ* |
Ga0075524_103750352 | 3300006950 | Arctic Peat Soil | MSVVELALAFLSGVVTGVLLDRWVLPPLVDAWIDRMRRHGQ* |
Ga0079219_100480882 | 3300006954 | Agricultural Soil | MNGLELVLAFLAGVLMGGALDFFVLPLLVDAWIDRRRRHGR* |
Ga0105044_107579603 | 3300007521 | Freshwater | MSEVELVLAFLSGVAMGIALDRWLLPSLVYAWIDQLRRHGR* |
Ga0102953_13311141 | 3300007775 | Soil | MSGIELVLAFLAGVVMGGALDRFVLPLLVDAWIDQVRRHWR* |
Ga0105049_111548521 | 3300007799 | Freshwater | MSEVELVLAFLSGVAMGIVLDRWLLPPLVDAWITRLRRHG |
Ga0066793_102917743 | 3300009029 | Prmafrost Soil | MSEVELALAFLWGVGMGIALDRWLLPPLVDAWIDRLRRHGR* |
Ga0066793_104085071 | 3300009029 | Prmafrost Soil | MSGVELALAFLSGVVMGILLDRWLLPPLVDAWIDRLRRHGR* |
Ga0066793_104228302 | 3300009029 | Prmafrost Soil | MSEVELVLAFLAGVVMGGALDRFVLPPLVDAWIDRLRWHGQ* |
Ga0066793_108795891 | 3300009029 | Prmafrost Soil | LRGGPMSGVELALALVSGVVMGILLDRWLLPSLVDAWIDRMRRHGR* |
Ga0105095_101903211 | 3300009053 | Freshwater Sediment | MSEVELALAFLSGVVMGILLDRWLLPPLVDAWLDRMRRHGR* |
Ga0105106_105139992 | 3300009078 | Freshwater Sediment | LGGPVSGLELVLAFLAGVVMGSGLDRFVLPLLVDAWIDRLRRDGR* |
Ga0105106_110325391 | 3300009078 | Freshwater Sediment | PCWFPMSGLELLLAFLAGVVMGGALDRFVLPLLVDAWIDRLRRHGR* |
Ga0105047_100374576 | 3300009083 | Freshwater | MSGLELVLAFLAGVVMGGALDRFVLPLLVDAWIDRLRRHGR* |
Ga0105103_104955661 | 3300009085 | Freshwater Sediment | MSEVELVLAFLAGVVMGGALDRFVLPLLVDAWIDRLRRHGR* |
Ga0105107_103258503 | 3300009087 | Freshwater Sediment | MSGIELVLAFLAGVVMGGALDRFVLPLRVDAWIDRLRRYGR* |
Ga0105107_105774492 | 3300009087 | Freshwater Sediment | VSGVELVLAFLAGVVMGGALDRFVLPRPVDAWIDRLRRHGR* |
Ga0102851_111271992 | 3300009091 | Freshwater Wetlands | MSGVELVLAFLAGVVMGGALDRFVLPILVDAWIDRL |
Ga0105094_101220861 | 3300009153 | Freshwater Sediment | MSGLELVAAFLAGVVMGGALDRFVLPLLVDAWIDRVRRHGR* |
Ga0105102_107052922 | 3300009165 | Freshwater Sediment | MSGVELLLAFLAGVVMGGALDRFVLPLLVDAWIDRVRRHGR* |
Ga0105097_105514521 | 3300009169 | Freshwater Sediment | MSGVELVLAFLAGVVMGGALDHFVLPLLVDAWIDRLRRHGR* |
Ga0130016_1002229113 | 3300009868 | Wastewater | MSGIELVAAFLAGVVMGVILDHVVLPLLVDAWIDRLHRHGR* |
Ga0131092_101050184 | 3300009870 | Activated Sludge | MSVVELVGAFLAGVAMGIAFDRWLLPALVDVWLDRLPRHGR* |
Ga0131092_101538446 | 3300009870 | Activated Sludge | MSGVELVAAFLAGVAMGIALDRWLLPSLVDVWIDGLRRHGR* |
Ga0131092_101973143 | 3300009870 | Activated Sludge | MSGAEPVLAFLAGVAMGIALDRFVLPVLVDAWIDRLRRHGR* |
Ga0131092_102241272 | 3300009870 | Activated Sludge | MNGLELVFAFLAGVVMGGALDRFVLPLLVDAWIDRLRRHGR* |
Ga0131092_107468721 | 3300009870 | Activated Sludge | MSGAEPVLAFLAGVAMGIALDRFVLPVLVDAWIDGLRRHGR* |
Ga0131077_103123193 | 3300009873 | Wastewater | MSGLDLIVAFLAGVVMGGALDFFVLPLLVDAWIDRLHRHGR* |
Ga0126310_100319574 | 3300010044 | Serpentine Soil | MSGMDLVAAFLAGVVMGGALDRFVLPLLVDAWIDRLRRHGR* |
Ga0126306_103698001 | 3300010166 | Serpentine Soil | MSGVELVLAFLAGVVMAGALDRFVLPLLVDAWIDRLRRHGR* |
Ga0136847_130365612 | 3300010391 | Freshwater Sediment | MTGVELALAFLSGVVMGILLDRWLLPLLVDAWIDRLRRHGR* |
Ga0151621_13485941 | 3300011267 | Sediment | SPMNGLELVVAFLAGVVMGIALDRWLLPPLVDAWIDRLRRHER* |
Ga0136621_13550252 | 3300012092 | Polar Desert Sand | MSAVDLAFAFLTGVAMGIVLDRWLLPPLVDAWITRLRRHGR* |
Ga0157216_100236601 | 3300012668 | Glacier Forefield Soil | MSGVELILAFLAGVVMGVALDRWLLPPLVDAWIDRMRRHGR* |
Ga0157216_100236606 | 3300012668 | Glacier Forefield Soil | MSWVELALAFLSGVVTGILLDRWLLPLLVDAWIDRMRRHGR* |
Ga0137335_10281982 | 3300012670 | Soil | MSGVELVLAFLAVVMGGALDRFVLPLLVDAWIDRLRRHGR* |
Ga0136612_104717011 | 3300012680 | Polar Desert Sand | MSGAELVAAFLAGVAMGIALDRFVLPLLVDAWIDRLRRHER* |
Ga0157308_101024082 | 3300012910 | Soil | MNGLELVLAFFTGVLLGGALDRFVLPVLVDAWIDRTRRHGR* |
Ga0153916_104975541 | 3300012964 | Freshwater Wetlands | MSGVELALAFFSGVVMGILLDRWLLPPLVDAWIDRMRRHGR* |
Ga0168316_1101803 | 3300012981 | Weathered Mine Tailings | MNGLELVLAFLTGVLMGGALDFFVLPLVVDAWIDGRRRHGR* |
Ga0164308_109276192 | 3300012985 | Soil | MSEVELLVAFLAGVVMGGALDRFVLPLVVDAWIDRLRRHGR* |
Ga0170573_104935382 | 3300013232 | Sediment | MSGVELTLAFLGGVVMGGALDRFALPLLVDLWIDRLRRHGR* |
Ga0173609_101249043 | 3300013315 | Sediment | MSGVELTLAFLGGVVMGGALDRFVLPLLVDLWIDRLRRHGR* |
Ga0173609_102911952 | 3300013315 | Sediment | MNGLDLVAAFLAGVVMGGALDRFVLPLLVDAWIDRLRRHGR* |
Ga0075308_10290422 | 3300014264 | Natural And Restored Wetlands | VSGIELVAAFLAGVLMGGALDRFVLPLLVDAWIDRLRRHGR* |
Ga0075314_11400112 | 3300014265 | Natural And Restored Wetlands | VSGVELVLAFLAGVVMGGALDRFVLPLLVDAWIDRLRRHGR* |
Ga0075344_10718343 | 3300014296 | Natural And Restored Wetlands | MSGFELVLAFLAGVVMGGALDRFVLPLLVDAWIDRRRRHGR* |
Ga0075341_10770633 | 3300014298 | Natural And Restored Wetlands | MNGLELVAAFLAGVVMGGALDRFVLPLLVDAWIDRLRRHGR* |
Ga0075341_11211111 | 3300014298 | Natural And Restored Wetlands | MSGLELVAAFLAGVVMGGALDRFVLPLLVDAWIDRLRRHGR* |
Ga0075303_11088053 | 3300014299 | Natural And Restored Wetlands | ELAVAFLAGVLMGGALDFFVLPLVVDAWIDRRRRHGR* |
Ga0075340_10089691 | 3300014304 | Natural And Restored Wetlands | MSGIELVLAFLAGVVMGGALDRFVVPLLVDAWIDRLRRQGR* |
Ga0075340_10830731 | 3300014304 | Natural And Restored Wetlands | MSEVALLLAFLAGVVMGGALDRFVLPLLVDAWIDRLRRHGR* |
Ga0075350_11824723 | 3300014315 | Natural And Restored Wetlands | MTGIELVLAFLAGVVMGGALDRFVLPLLVDAWIDRLRRHGR* |
Ga0075351_11066862 | 3300014318 | Natural And Restored Wetlands | MSGSELALAFLSGVAMGIVLDHQLLPPLVDAWIDRLRQHGR* |
Ga0075353_10099394 | 3300014321 | Natural And Restored Wetlands | MSGVELVLAFLAGVVTGGALDRFVLPLLVDAWIDRLRRHGR* |
Ga0075352_10311192 | 3300014324 | Natural And Restored Wetlands | MSGIELVLAFLAGVIMGGALDRFVLPLLVDAWIDRLRRHGR* |
Ga0182010_101306333 | 3300014490 | Fen | MSEIDLALAFLSGVVTGVLLDRWVLPPLVDMWIERTRRHGQ* |
Ga0182011_101914341 | 3300014496 | Fen | MSEIDLDLAFLSGVVTGVLLDRWVLPPLVDMWIERTRRHGQ* |
Ga0182011_106886612 | 3300014496 | Fen | MSEVDLALAFLSGVATGVLLDRWVLPPLVDAWIDRMRRHGR* |
Ga0182019_102644901 | 3300014498 | Fen | MSEVDLALAFLAGVVMGILLDRWVLPPLVDAWIDRLRRHGR* |
Ga0182021_107035032 | 3300014502 | Fen | MELVLAFLAGVVMGGALDRFVLPLVVDAWIDRLRRHGR* |
Ga0182021_112079351 | 3300014502 | Fen | MSGVELALAFLSGVAAGVLLDRWVPPPLVDAWIDRMRRHGR* |
Ga0182021_119024302 | 3300014502 | Fen | MSGVELALAFLAGVGVGILLDRWLLPPLVDAWIDRLRRHGR* |
Ga0182027_112565732 | 3300014839 | Fen | MSEIDLALAFLSGVVTGVLLDRWVLPPLVDMWTERMRRHGQ* |
Ga0180084_10592481 | 3300014874 | Soil | MSGIEFVLAFLAGVDMGGDLERFVLPLLVDAWIDRLRRHGR* |
Ga0157376_119589852 | 3300014969 | Miscanthus Rhizosphere | MSEVDLAIAFLTGIVLGLVLDRLLLPPLVDAWIDRMRRHGR* |
Ga0167659_10863992 | 3300015191 | Glacier Forefield Soil | MSEVELAFAFLSGVVTGILLDRWLLPPLVDLWIDRLRRHGR* |
Ga0167647_10064567 | 3300015199 | Glacier Forefield Soil | MSGIALALLSGVVTGVLLDRWVLPALVDLWIDRMRRHGQ* |
Ga0167647_10296013 | 3300015199 | Glacier Forefield Soil | MSGVELVLAFLAGVAMGIALDRWLLPSLVDAWIDRLRRHGR* |
Ga0167664_100019520 | 3300015208 | Glacier Forefield Soil | MSGVELVLTFLAGVGMGIALDRWLLPPLVDAWIDRLRRHGQ* |
Ga0167664_10371503 | 3300015208 | Glacier Forefield Soil | MSGVELALAFLSGVVTGIVLDRWLLPSLVDAWIYRMRRHGR* |
Ga0180072_11026162 | 3300015250 | Soil | MSGLELPLAFLAGDVKSGALDRFVLPLLVDAWIDRLRRHGR* |
Ga0163144_109947873 | 3300015360 | Freshwater Microbial Mat | MSAGDLAFAFLTGVAMGIVLDRWLLPPLVDAWITRLRRHGR* |
Ga0132256_1017694301 | 3300015372 | Arabidopsis Rhizosphere | VSAAELLITFLSGIGMGIALDRWLIPPLVDAWIDHVRRYGR* |
Ga0183260_102461222 | 3300017787 | Polar Desert Sand | MSGVELVLAFLAGVAMGIALDRWLLPPLVDAWITRARRHGQ |
Ga0184616_103417331 | 3300018055 | Groundwater Sediment | MSEVELALAFLSGVVMGILLDRWLLPPLVDAWIDRMRRHGR |
Ga0190269_100402615 | 3300018465 | Soil | MSGVELVLAFLAGVVMGGALDRFVLPLLVDAWIDRLRRHGR |
Ga0190269_115470041 | 3300018465 | Soil | MGAMSGLELVLAFLAGVVMGGALDRFVLPLLVDAW |
Ga0190271_138314351 | 3300018481 | Soil | MSGEELILAFLAGVVMGGALDRFVLPLIVDVWIDRTQRHGR |
Ga0163151_103924822 | 3300020057 | Freshwater Microbial Mat | QPRWGSMSGVELVLAFLAGVVMGGALDRFVLPLLVDAWIDRLRRHGR |
Ga0194039_10942543 | 3300020163 | Anoxic Zone Freshwater | MSGIELVLAFLAGVVMGGALDRFVLPLLVDAWIDRLRRHGR |
Ga0163153_101095231 | 3300020186 | Freshwater Microbial Mat | MSAGDLAFAFLTGVGMGIALDRWLLPPLVDAWIDRLRRHGQ |
Ga0163153_101349362 | 3300020186 | Freshwater Microbial Mat | MSEIELAVAFLSGVVTGVLLDRWLLPPLVDLWIARLRRHGR |
Ga0194132_104797862 | 3300020214 | Freshwater Lake | MNGLELVLAFLAGVVMGGALDFFVLPLLVDAWIDRLRRHGR |
Ga0210379_100793752 | 3300021081 | Groundwater Sediment | MSGVELVVAFLAGVVMGGALDRFVLPLLVDAWIDRLRRHGR |
Ga0210362_12673551 | 3300021329 | Estuarine | MNGLELVLAFLAGVVMGGALDHFVLPLLVDAWIDRLRRHGR |
Ga0210339_11026081 | 3300021332 | Estuarine | HLPDGPMSGLELVLAFLAGVLMGGALDRFVLPLLVDAWIDRLRRHGR |
Ga0210339_16059322 | 3300021332 | Estuarine | MSGAELVLAFLAGVVMGGALDHFVLPLLVDAWIDRLRRHGR |
Ga0224497_100034709 | 3300022209 | Sediment | VSGIELALAFLAGVVMGGALDRFVLPLLVDAWIDRLRRHGR |
Ga0224500_100094515 | 3300022213 | Sediment | MSGVELLLAFLAGVVMGGALDRFVLPLLVDAWIDRLRRHGR |
Ga0224500_100788334 | 3300022213 | Sediment | MSGVELVAAFLAGVAMGIALDRWLLPSLVDAWIDRLRRHER |
Ga0224505_100085252 | 3300022214 | Sediment | MNGLELVLAFLAGVVMGGALDRFVLPLLVDAWIDRLRRHGR |
Ga0224505_100292825 | 3300022214 | Sediment | VSGVELVAAFLAGVAMGGALDRFVLPLLVDAWIDRLRRHER |
Ga0209320_103517631 | 3300025155 | Soil | MSGVELALAFLAGAVMGGALDRFVLPLLVDAWIDRLRRHGR |
Ga0209619_100265495 | 3300025159 | Soil | MSGVELVAAFLAGVVMGGALDRYVLPLLVDAWIDRLRRHGR |
Ga0209109_104574561 | 3300025160 | Soil | RGNPMSGVELVLAFLAGAVMGGALDRFVLPLLVDAWIDRLRRHGR |
Ga0209324_101485723 | 3300025174 | Soil | MSGVELVAAFLAGVVMGGALDRFVLPLLVDAWIDRLRRHGR |
Ga0209212_100529715 | 3300025309 | Soil | MSGIELVAAFLAGVGMGGALDRFVLPLLVDAWIDRLRRHGR |
Ga0209519_103499822 | 3300025318 | Soil | MSGLELVLAFLAGVVMGGALDRFVLPLLVDAWIDRLRRHGR |
Ga0208079_11015591 | 3300025481 | Arctic Peat Soil | MSEVELAVAFLSGVIMGVVLDRWLLPRLVDAWIDRMRRHGQ |
Ga0208587_10707702 | 3300025484 | Arctic Peat Soil | MSEVELALAFLSGVVMGILLDRWLLPPLVDAWIDRMRRHGQ |
Ga0208610_1184601 | 3300025493 | Serpentinite Rock And Fluid | MSEVELVLAFLSGVAMGIALDRWLLPPLVDAWIDRLSRHGR |
Ga0208733_1257422 | 3300025515 | Serpentinite Rock And Fluid | MSGVELLLAFLAGVVLGIALDRWLLPPLVDAWIDRLRRRGR |
Ga0210083_10197505 | 3300025521 | Natural And Restored Wetlands | GSMSVVELVLAFLAGVVMGGALDRWLLPLLVDAWIDRQRRHGR |
Ga0210087_10707642 | 3300025559 | Natural And Restored Wetlands | MSGVELVLAFLAGVVMGGALDRFVLPRLVDAWIDRLRRHGR |
Ga0210133_11020821 | 3300025573 | Natural And Restored Wetlands | MSGIVLVLAFLSGVVMGGALDRLVLPLLVDAWIDRLRRHGR |
Ga0210138_10021174 | 3300025580 | Natural And Restored Wetlands | MSGSELALAFLSGVAMGIVLDHQLLPPLVDAWIDRLRQHGR |
Ga0210138_10063175 | 3300025580 | Natural And Restored Wetlands | PRLRPMNGLELAVAFLAGVLMGGALDFFVLPLVVDAWIDRRRRHGR |
Ga0209744_10868543 | 3300025692 | Arctic Peat Soil | MSGVELGLAFLSGVVMGILLDRWLLPPLVDAWIHRMRRHGR |
Ga0209745_10366414 | 3300025739 | Arctic Peat Soil | MSGVELGLAFLSGVVMGILLDRWLLPPLVDAWIDRMRRHGR |
Ga0209747_10112305 | 3300025750 | Arctic Peat Soil | MSEVELAIAFFSGVVMGILLDRWLLPPLVDAWIDRMRRHGR |
Ga0209538_11459162 | 3300025846 | Arctic Peat Soil | MSEVELALAFLWGVGMGIALDRWLLPPLVDAWIDRLRRHGR |
Ga0209538_12124912 | 3300025846 | Arctic Peat Soil | MSDVDLVLAFLAGVVTGVLLDRWLLPPLVDAWIDRMRRHGR |
Ga0209014_101949062 | 3300025857 | Arctic Peat Soil | MSGVELALAFLSGVVTGVLLDRWVLPPLVDAWIDRLRRHGQ |
Ga0209226_101145844 | 3300025865 | Arctic Peat Soil | PRRQPDEGSMSEIELALAFLSGVVMGILLDRWLLPPLVDAWIDRMRRHGR |
Ga0209226_102785412 | 3300025865 | Arctic Peat Soil | MSEVELALAFLAGVVMGGALDRFVLPLLVDVWIDRLRRHGR |
Ga0207707_111526022 | 3300025912 | Corn Rhizosphere | MNGLELVLAFLAGVVMGGVPDRLVVPLIVDAWIDRLRRHGR |
Ga0210126_1045572 | 3300025946 | Natural And Restored Wetlands | MSEVELLLAFLAGVVMGGALDRFVLPLLVDAWIDRLRRHGR |
Ga0210077_10882141 | 3300025952 | Natural And Restored Wetlands | VNGLELVAAFLAGVVMGGALDRFVLPLLVDAWIDQVRRHGR |
Ga0208915_10149341 | 3300026048 | Natural And Restored Wetlands | MSGVELALAFLAGVAMGIALDRVVLPMLVDAWIDRLRRHGR |
Ga0207862_12071401 | 3300027703 | Tropical Forest Soil | VTVVELALAFLWGVAMGVALDRWVLPPIVDAWVDRMRRHGR |
Ga0209514_1000061810 | 3300027819 | Groundwater | MSEVELALAFLSGVVTGVLLDRWVLPPLVDAWIDRMRWHGR |
Ga0209797_101078001 | 3300027831 | Wetland Sediment | MSGVELVLAFLAGVVMGGALDRFVLPLLVDAWIDRLRRHER |
Ga0209262_101672632 | 3300027841 | Freshwater | MSGVELVLAFLAGVVMGGALDRFVLPLLVNAWIDRLRRHGR |
Ga0209798_101234922 | 3300027843 | Wetland Sediment | MSGLELLLAFLAGVVMGGALDRFVLPLLVDAWIDRLRRHGR |
Ga0209166_102291252 | 3300027857 | Surface Soil | MSGVELVLAFLAGVAMGIALDRFVLPLLVDAWIDRLRRHER |
Ga0209450_100959985 | 3300027885 | Freshwater Lake Sediment | MSEVELALAFLSGVVMGILLDRFVLPLLVDAWIDRLRRHGR |
Ga0208980_102199402 | 3300027887 | Wetland | MSGVELVLAFFAGVVMGGALDRFVLPLLVDAWIDRLRRHGR |
Ga0209777_100145657 | 3300027896 | Freshwater Lake Sediment | MSGVELALAFFSGVVLGILLDRWLLPPLVDAWIDRMRRHGR |
Ga0209777_100223572 | 3300027896 | Freshwater Lake Sediment | MSEIELALAFLSGVVTGVLLDRWVLPPLVDLWIDRMRRHGQ |
Ga0209777_100292044 | 3300027896 | Freshwater Lake Sediment | MSEVELALAFLSGVVTGVLLDRWVLPPLVDLWIDRMRRHGQ |
Ga0209777_100449887 | 3300027896 | Freshwater Lake Sediment | MTGVELALAFLSGVVMGILLDRWLLPPLVDAWIDRLRRHGR |
Ga0209777_104896083 | 3300027896 | Freshwater Lake Sediment | MSEIDLALAFLSGVVTGVLLDRFVLPLLVDAWIDRMRRHGQ |
Ga0209777_107055652 | 3300027896 | Freshwater Lake Sediment | MSEVELGLAFRSGVVIGILLDRWLLPPLVDAWIARMRRHGR |
Ga0209777_107154701 | 3300027896 | Freshwater Lake Sediment | MSEVELTLAFLSGVVMGTLLDRWLLPPLVDTWIDRMRRHGR |
Ga0209254_100204003 | 3300027897 | Freshwater Lake Sediment | MSGVELVLAFLSGVAMGDALDRFVLPLLVDAWIDRLRRHGR |
Ga0209254_100323574 | 3300027897 | Freshwater Lake Sediment | MSGVELALAFLSGVVMGMVLDRRLLPLLVDAWIDRMRRHGR |
Ga0209254_100715754 | 3300027897 | Freshwater Lake Sediment | MSEVELGLAFLSGVGMGILLDRWVLPPLVDAWIDRMRRHGQ |
Ga0209254_100933526 | 3300027897 | Freshwater Lake Sediment | MSGFELVLAFLAGVVMGGALDRFVLPLLVDAWIDRLRRHGR |
Ga0209253_102864022 | 3300027900 | Freshwater Lake Sediment | MSGVELALAFLAGVVMGGALDRFVLPLLVDAWIDRLRRHGR |
Ga0209253_103400932 | 3300027900 | Freshwater Lake Sediment | MNGLELVLAFLGGVLMGGALDRFVLPLLVDAWIDRLRRHGR |
Ga0209048_102334172 | 3300027902 | Freshwater Lake Sediment | MSEVELALAFLSSVVMGMVLDRWLLPPLVDAWIDRMRRHGR |
Ga0209048_103180092 | 3300027902 | Freshwater Lake Sediment | MSRVELVLAFLAGVVMGGALDRFVLPLLVDAWIDRLRRHER |
Ga0209048_109994522 | 3300027902 | Freshwater Lake Sediment | PRRQPRERSMSEVELGLAFRSGVVIGILLDRWLLPPLVDAWIARMRRHGR |
Ga0307281_100585322 | 3300028803 | Soil | MTGIELVFALLAGVAMGIALDRWLLPPLVDAWIDRLRRHGR |
Ga0302291_102118233 | 3300028865 | Fen | MSGIELVVAFLAGVVMGGALDRFVLPLLVDAWIDRLRRHGR |
Ga0302163_100312603 | 3300028868 | Fen | MSEGELALAFLSGVVTGVVLDRWVLPPLVDAWVDRLRRA |
Ga0299907_102200232 | 3300030006 | Soil | MSGVELILAFLAGVVMGGALDRFVLPLLVDAWIDRLRRHGR |
Ga0302299_101288861 | 3300030010 | Fen | LLAFLAGVVMGGALDRFVLPLLVDAWIERMRRHGR |
Ga0302299_102927421 | 3300030010 | Fen | MNGVELILAFLAGVVMGGALDRFVLPLLVDAWIDRLRRHGR |
Ga0302286_105046602 | 3300030047 | Fen | MNGLELVLALLAGVVMGGALDRWVLPPLADVWIDRMRRHGR |
Ga0311333_100237551 | 3300030114 | Fen | MNGLELVLALLAGVVMGGALDRWVLPPLADVWIDRM |
Ga0311349_107132411 | 3300030294 | Fen | MSLVELALAFLAGVAMGGALDRFVLPILVDAWIGRRRHGR |
Ga0302046_100873113 | 3300030620 | Soil | MSGVELFLAFLAGVVMGGALDRFVLPLLVDAWIDRLRRHGR |
Ga0299913_107208574 | 3300031229 | Soil | MSGVELVLAFLAGVVMGGALDRFVLPLLVDAWIDRPRRHGR |
Ga0302323_1007169792 | 3300031232 | Fen | MSLVELALAFLAGVVMGGALDRFVLPLLVDAWIERMRRHGR |
Ga0302323_1026180432 | 3300031232 | Fen | MSGVELVLAFLAGVAMGGALDHFVRPLLVDAWIDRLRRHGR |
Ga0302323_1030589733 | 3300031232 | Fen | PRRHPRGVPVSEMELVLAFLAGVVMGGALDRFVLPLVVDAWIDRLRRHGR |
Ga0315556_100353213 | 3300031256 | Salt Marsh Sediment | VNGIELVVAFLAGVVMGGALDRFVLPLLVDAWIDRLRRHGR |
Ga0307418_10017831 | 3300031341 | Salt Marsh | VSGVELILAFLAGVVMGGALDRFVLPLLVDAWIDQVRRHGR |
Ga0272433_100294316 | 3300031450 | Rock | MSGVELALAFLSGVVMGILLDRWVLPPLVDAWIDRLRRHGR |
Ga0311364_100194371 | 3300031521 | Fen | MNGLELVLALLAGVVMGGALDRWVLPPLADVWIDR |
Ga0307380_100363131 | 3300031539 | Soil | MSGLELVAAFLSGIAMGIALDRWLLPSLVDAWIDRLRRHGR |
Ga0307380_103032381 | 3300031539 | Soil | PVSGVELVLAFLAGMAMGIALDRWLLPSLVDAWIDRLHRHGR |
Ga0307380_103064396 | 3300031539 | Soil | MSGVELVLAFLAGVAMGIALDRWLLPSLVDAWIDRLRRHGQ |
Ga0307380_107393033 | 3300031539 | Soil | MSGIELVLAFFAGVAMGIALDRWLLPSLVDAWIDRLRRHGR |
Ga0307379_100253675 | 3300031565 | Soil | VSGVELVLAFLAGMAMGIALDRWLLPSLVDAWIDRLRRHGR |
Ga0307379_108438141 | 3300031565 | Soil | MSGVELVAAFLSGIAMGIALDRWLLPSLVDAWIDRLRRHGR |
Ga0307379_115378072 | 3300031565 | Soil | MNGVELILAFLAGVVMGIVLDRYVLPLLVDAWIDRLRRHGR |
Ga0247727_100384432 | 3300031576 | Biofilm | VSGIELVVAFLAGVAMGIALDRWLLPPLVDAWIDRLPRHGR |
Ga0315535_13443341 | 3300031699 | Salt Marsh Sediment | PRRQLLRPPVSGVELILAFLAGVVMGGALDRFVLPLLVDAWIDQVRRHGR |
Ga0315291_114825193 | 3300031707 | Sediment | RPRRQPCGPVSGVELVLAFLAGVVMGGALDRFLLPLLVDAWIDRLRRHGR |
Ga0316576_108621861 | 3300031727 | Rhizosphere | MNGLELVLAFLAGVAMGGALDRFVLPLLVDAWTDQVRRHGR |
Ga0315293_101029355 | 3300031746 | Sediment | MSGVELTLAFLSGVVMGGALDRWLLPPLVDAWIDRLRRHGR |
Ga0315293_101110263 | 3300031746 | Sediment | MSGVELILAFLVGVAMGIALDHFVLPLLVDAWIDRLRRHGR |
Ga0315293_106479764 | 3300031746 | Sediment | RPRRQLSGGPMSGVELVLAFLGGVAAGIALDRWLLPPLVDAWIDRLRRHGR |
Ga0315288_100816387 | 3300031772 | Sediment | MSGVELVLAFLGGVAAGIALDRWLLPPLVDAWIDRLRRHGR |
Ga0315288_100916156 | 3300031772 | Sediment | MSGVELILAFLVGVAMGIALDRFVLPLLVDAWIDRLRRHGR |
Ga0315290_100211134 | 3300031834 | Sediment | VSGVELALAFLAGVAMGIALDRWLLPPLVDAWIDRLRRHGR |
Ga0315290_101077312 | 3300031834 | Sediment | MSGIELVLAFLAFLAGVAMGIALDHWLLPPLADAWINRLRRHGR |
Ga0315290_101154623 | 3300031834 | Sediment | MSGVELILAFLAGVVMGGALDRWVLPLLVDAWIDRLRRHGR |
Ga0315290_108104391 | 3300031834 | Sediment | GRPMSGVELVLAFLAGVVMGGALDRFVLSLLVDAWIDRLRRHGR |
Ga0315297_1000066712 | 3300031873 | Sediment | MSGVELVLAFLAGVVMGGALDHFVLPLLVDAWIDRLRRHGR |
Ga0315297_102241444 | 3300031873 | Sediment | MNGLELVLAFLAGVVMGGALDRFVLPLLVDAWTDRLRRHGR |
Ga0302322_1039053222 | 3300031902 | Fen | MSEVELVLAFLAGVVMGGALDRFVLPLLVDAWIDRLRRHGR |
Ga0307407_103135921 | 3300031903 | Rhizosphere | MSGVELVIAFLAGVVMGGALDRIVLPLLVDAWIDRTHRHGQ |
Ga0311367_104965454 | 3300031918 | Fen | PVSGIELALAFLAGVVMGGALDRFVLPLLVDAWIERLRRHGR |
Ga0311367_109635232 | 3300031918 | Fen | VSEVELALAFLAGVVMGGALDRFVLPLLVDACAGAPG |
Ga0326597_100621225 | 3300031965 | Soil | MSGVELALAFLSGVAMGIVLDRWLLPPLVDAWIDRLRRHGR |
Ga0326597_111587882 | 3300031965 | Soil | MSGVELILAFLAGVVMGGTLGRFVLPLLVDAWIDRLRRHGR |
Ga0326597_114626781 | 3300031965 | Soil | MSGVELILAFLAGVVMGGALDRFVLPPLVDAWIDRLRRHGR |
Ga0315278_100365455 | 3300031997 | Sediment | MSELELALAFLAGVVMGGALDRFVLPLLVDAWIDRLRRHGR |
Ga0315278_100428046 | 3300031997 | Sediment | MSEVELVAAFLAGVVMGGALDHFVLPLLVDAWIDRLRRHGR |
Ga0315278_100570899 | 3300031997 | Sediment | MSGIELVLAFLAFLAFLAGVAMGIALDHWLLPPLADAWINRLRRHGR |
Ga0315278_101648202 | 3300031997 | Sediment | MSGVELILAFLAGVVMGGALDRWLLLPLVDAWIDRLRRHGR |
Ga0315278_103012302 | 3300031997 | Sediment | VSGVELVLAFLAGVVMGGALDRFLLPLLVDAWIDRLRRHGR |
Ga0315278_103235172 | 3300031997 | Sediment | MSEVELALTFLSGVVTGILLDRFVLPPLVDAWIDRLRRLGQ |
Ga0315278_106034652 | 3300031997 | Sediment | MSGVELVAAFLAGVAMGIALDRWLLPLLVDAWIDRLRRHGR |
Ga0315278_109717611 | 3300031997 | Sediment | MSGVELVLAFLAGVIMGGALDRFVLPLLVDAWIDRLRRHGR |
Ga0315278_113073863 | 3300031997 | Sediment | MSGVELVAAFLAGVLMGGALDHFVLPLVVDAWIDRLRRHGR |
Ga0315278_113231371 | 3300031997 | Sediment | MTGVELVLAFLAGVAMGGALDRFVLPLLVDAWIDRLRRHGR |
Ga0315278_113612362 | 3300031997 | Sediment | VSGIELVLAFLAGVVMGGALDRFVLPLLVDAWIDRLRRHGR |
Ga0315278_115040472 | 3300031997 | Sediment | MSGVDLVVAFLAGVAMGIALDRFELPLLVDPWIDRLRRHGR |
Ga0315278_115054741 | 3300031997 | Sediment | MSDVDLVLAFLSGVVMGILLDRWLLPLLVDAWIDRLRRHGR |
Ga0315278_119883102 | 3300031997 | Sediment | MSGVELVLAFLAGVVMGGALDRFVLPLLVDAWIDRMRRHGR |
Ga0315272_100959841 | 3300032018 | Sediment | MSGLELVAAFLAGVVMGGALDRFVLPLLVDAWIDRLRRHGR |
Ga0315272_105687942 | 3300032018 | Sediment | MTGIELALAFLWGVAMGVALDRWVLPPLVDVWVGRPRRHGR |
Ga0315272_105849541 | 3300032018 | Sediment | MSGVELVLAFLAGVVMGGALDRFVLPLLVDAWIGRRRHGR |
Ga0315540_100303783 | 3300032061 | Salt Marsh Sediment | MSGFELVLAFLAGVIMGGALDRFVLPLLVDAWIDQVRRHGR |
Ga0315540_102218892 | 3300032061 | Salt Marsh Sediment | VSGIELVLAFLAGVVMGGALDRFVLPLLVDVWIDQVRRHGR |
Ga0315292_103601864 | 3300032143 | Sediment | MNGVELVLAFLAGVVMGGALDRFVLPLLVDAWIDRLRRHGR |
Ga0315292_103950803 | 3300032143 | Sediment | MSEVELVAAFLASVIMGGALDRFVLPLLVDAWIDRLRRHGR |
Ga0315292_104267823 | 3300032143 | Sediment | MSGIELVLAFLAGVAMGIALDHWLLPPLADAWINRLRRHGR |
Ga0315292_110053712 | 3300032143 | Sediment | MSGVELVLAFLAGVVMGGALDRFVLSLLVDAWIDRLRRHGR |
Ga0315295_103118541 | 3300032156 | Sediment | SGVELVLAFLGGVAAGIALDRWLLPPLVDAWIDRLRRHGR |
Ga0315281_103596721 | 3300032163 | Sediment | VSGVELVLAFLAGVGMGILLDRWLLPSLVDAWIDQLRRHGQ |
Ga0315281_104538672 | 3300032163 | Sediment | MSGVELVVAFLSGVVMGILLDRWLLPPLVDAWIDRMRRHGR |
Ga0315281_121642411 | 3300032163 | Sediment | MNGIELAVAFLAGVAMGIALDRFVLPMLVDAWIDRLRRHGR |
Ga0315283_109746573 | 3300032164 | Sediment | MSGVELVLAFLAGVVMGGALDRFVLPPLVDAWIDRLRRHGR |
Ga0315283_110228391 | 3300032164 | Sediment | VSEVELVLAFLAGVVMGILLDRWVLPPLVDLGIDRMRRHGR |
Ga0315283_114839982 | 3300032164 | Sediment | MSGIELVAAFLAGVAMGIALDRWLLPSLVDAWIDRLRRHGQ |
Ga0315283_120448843 | 3300032164 | Sediment | PRDGSMSEIELALAFLSGVVMGILLDRWLLPPLVDAWIDRMRRHGR |
Ga0315268_100094528 | 3300032173 | Sediment | MSGVELILAFLAGVAMGIALDRWLLPPLVDAWIDRLRRHGR |
Ga0315268_104413802 | 3300032173 | Sediment | MSGVELVLTFLAGVVMGGALDRFVLPLLVDAWIDLLRRHGR |
Ga0315268_117717532 | 3300032173 | Sediment | MSGVELVLAFLAGVVMGGALDRFVLPLLVDAWIDRLRRNGR |
Ga0315271_101438342 | 3300032256 | Sediment | MSGVELVLAFLAGVAMGIALDRWLLPPIVDAWIARMRRHGR |
Ga0315271_106362301 | 3300032256 | Sediment | VSGVELVLAFLAGVLPGGALDRFQLPLLVDAWIDRLRRHRR |
Ga0315271_107323383 | 3300032256 | Sediment | RRQQRGSPMSGLELVLAFLSGVAMGILLDRWLLPTLVDAWIDRMRRHGR |
Ga0315271_110830141 | 3300032256 | Sediment | QPHEGSMSGVELVAAFLAGVAMGIALDRWLLPLLVDAWIDRLRRHGR |
Ga0315270_104091372 | 3300032275 | Sediment | MSGVELVLAFLGGVAAGIALDRWLLPPLVDAWIDRMHRHGR |
Ga0315270_104971151 | 3300032275 | Sediment | MSGVELALAFLSGVVTGVLLDRWVLPPLVDLWIARMRRHGR |
Ga0315270_107656562 | 3300032275 | Sediment | MSGVELVLAFLAGVAMGIALDRWLLPPLVDAWIDRLRRHGR |
Ga0315270_109274361 | 3300032275 | Sediment | MSGVELALAFLSGVVMGGALDRFVLPFLVDAWIDR |
Ga0315270_110623221 | 3300032275 | Sediment | RPRRHPGGGAMSGVELVLAFLAGVVMGGALDRFVLPLLVDAWIGRRRHGR |
Ga0315286_104224871 | 3300032342 | Sediment | LALAFLSGVVIGILLDRSLLPPLVDAWIDRMRRPGR |
Ga0315286_121804081 | 3300032342 | Sediment | GSMSEVELALAFLSGVATGVLLDRWVFPPLVDLWIDRMRRHGQ |
Ga0315287_101790511 | 3300032397 | Sediment | MSGAELVLAFLAGVVMGGALDRFVLPLLVDAWIDRLRRHGR |
Ga0315287_106480694 | 3300032397 | Sediment | MSEVELILAFLVGVAMGIALDRWLLPPLVDAWIDRLRRHGR |
Ga0315287_106950252 | 3300032397 | Sediment | MSGIELVLAFLAGVVMGGALDRFVLPLLVDAWIGRLRRHGH |
Ga0315287_112210361 | 3300032397 | Sediment | ELVLAFLAGVVMGGALDRFVLPLLVDAWIDRLRRHGR |
Ga0315287_124950232 | 3300032397 | Sediment | MSGVELVLAFLAGVIMGGALDRFVLPLLVDAWIARLRRHGR |
Ga0315287_127393733 | 3300032397 | Sediment | MSGVELILAFLAGVIMGGALDRFVLPLLVDAWIDRLRRHGR |
Ga0315275_121549231 | 3300032401 | Sediment | PRRHLPGGPMSGVELVLAFLAGVVMGGALDRFVLPLLVDAWIDRLRRHGR |
Ga0315273_115352101 | 3300032516 | Sediment | MSEIDLVLAFLSGVVTSVLLDRWLLPPLVDAWIDRMHRHGR |
Ga0315273_121486072 | 3300032516 | Sediment | MSGVELVLAFLAGVVMGGALDRFMLPLLVDAWIDQLRRHGR |
Ga0334722_1000480116 | 3300033233 | Sediment | MSEVELALAFLAGVVMGVLLDRFVLPLLVDAWIDRLRRHGR |
Ga0334722_100217054 | 3300033233 | Sediment | MSGIELALAFSSGVVMGIALDRWLLPPLVDAWIDRLRRHGR |
Ga0334722_101028325 | 3300033233 | Sediment | MSGVELVLAFLAGVAMGGALDRFVLPLLVDAWIDRLRRHGR |
Ga0334722_103580311 | 3300033233 | Sediment | ALAFLAGVVMGGALDRFLLPLLVDAWIDRLRRHGR |
Ga0316603_111562952 | 3300033413 | Soil | MSGVELVLAFLAGVVIGGALDRFVLPLLVDAWIDRLRRYGR |
Ga0316616_1018863462 | 3300033521 | Soil | MSGVELIAAFLAGVVMGGALDRFVLPLLVDAWIDRLRRHGR |
Ga0334811_101013_267_392 | 3300033891 | Soil | MSEVDLALAFLAGVVMGILLDRWVLPPLVDAWIDRLRRHGQ |
Ga0373890_026684_508_633 | 3300034053 | Sediment Slurry | MSGLDLIVAFLAGVVMGGALDFFVLPLLVDAWIDRLHRHGR |
Ga0373891_078988_128_253 | 3300034054 | Sediment Slurry | MSGLDLIVAFLAGVVMGGALDRFVLPLLVDAWIDRLRRHGR |
Ga0373899_006193_975_1079 | 3300034077 | Sediment Slurry | MSGVELVLAFLAGVVMGGALDRFVLPLLVDAWIDR |
Ga0373899_008525_54_179 | 3300034077 | Sediment Slurry | MSGLDLIVAFLAGVVMGGALDRFVLPILVDAWIDRLRRHGR |
Ga0370484_0012161_2_106 | 3300034125 | Untreated Peat Soil | MSGVELVAAFLAGVVMGGALDRFVLPLLVDAWIDR |
Ga0364942_0102450_421_546 | 3300034165 | Sediment | MSGVELILAFFAGVAMGIALDRWLLPSLVDAWIDRLRRHGR |
Ga0370481_0005631_2069_2191 | 3300034281 | Untreated Peat Soil | MSEVELTLAFLAGVVMGGALDRFVTPLLVDAWIGRCRDGQ |
Ga0364936_073437_7_132 | 3300034773 | Sediment | MNGVELALAFSSGVAMGIGLDRWLLPVLVDAWIDRLRRHER |
⦗Top⦘ |