Protein Family IF13977
Metagenome
Isolate
193
Members
165
Samples
63
Scaffolds
512.4
Avg Length
Representative Sequence
- ID
- iso_pr_bacteria|8069511479|8069515600|
- Length
- 584 aa
- Sequence
- MPDTLNGRRSAGRSGNPLRDPRDRRLNRIAGPSSLVLFGVTGDLARKKLMPAVYDLANRGLLPPSFALVGFGRRDWDNEDFAAEVKDAVKAYARTPFDEAVWNQLSEGIRFVRGAFDDDAAFERLGETIGELDGNRGTRGNHAFYLSIPPKAFEQVCRQLSKHGLAQAGGEKWRRVVIEKPFGHDLASARQLNDIVESVFPADAVFRIDHYLGKETVQNILALRFANQLFEPLWNANYVDHVQITMAEDIGTGGRAGYYDGVGAARDVIQNHLLQLLALTAMEEPISFNADDLRAEKEKVLAAVRLPEDLSTHSARGQFAGGWQGGEQVQGYLEEEGIPADSKTETYAAIRVDINTRRWAGVPFYLRAGKRLGRRVTEIAVVFKRAPNLLFRDHGDDDFGQNAVVIRVQPDEGATIRFGSKVPGTQMEVRDVTMDFGYGHSFTESSPEAYERLILDVLLGEPPLFPRHEEVELSWKILDPFEEYWAGLGEQXXXXDVTMDFGYGHSFTESSPEAYERLILDVLLGEPPLFPRHEEVELSWKILDPFEEYWAGLGEQPEPYAPGSWGPASADELLARDGRTWRRP
Sample Types
Isolate
67.4%
Metagenome
32.6%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Unclassified
28.1%
Termitidae
13.7%
Apidae
11.8%
Formicidae
11.8%
Anthocoridae
5.9%
Scarabaeidae
4.6%
Tenebrionidae
4.6%
Cambaridae
4.6%
Culicidae
3.9%
Elmidae
2.6%
Hydrophilidae
1.3%
Armadillidiidae
1.3%
Curculionidae
1.3%
Hodotermitidae
0.7%
Siricidae
0.7%
Pyralidae
0.7%
Chironomidae
0.7%
Ixodidae
0.7%
Cerambycidae
0.7%
Cimicidae
0.7%
Taxonomy
Archaea
0
Bacteria
186
Eukaryota
0
Viruses
0
Unclassified
7
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2504756063 | Isoptericola variabilis J5 | Isolate | Unclassified |
| 2 | 2597490194 | Bifidobacterium coryneforme LMG 18911 | Isolate | Apidae |
| 3 | 2648501322 | Streptomyces sp. SA3_actF | Isolate | Unclassified |
| 4 | 2671180601 | Bifidobacterium asteroides DSM 20089 | Isolate | Unclassified |
| 5 | 2856882415 | Pseudonocardia sp. Ae406_Ps2 | Isolate | Formicidae |
| 6 | 2859977607 | Pseudonocardia sp. Ae707_Ps1 | Isolate | Formicidae |
| 7 | 2864964650 | Tsukamurella ocularis S00236 | Isolate | Elmidae |
| 8 | 2873589062 | Phycicoccus sp. HDW14 | Isolate | Hydrophilidae |
| 9 | 2884613238 | Agromyces intestinalis KACC 19306 | Isolate | Scarabaeidae |
| 10 | 2900354037 | Nocardia macrotermitis RB20 | Isolate | Termitidae |
| 11 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 12 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 13 | 3300056814 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE (version 2) | Metagenome | Tenebrionidae |
| 14 | 3300056857 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS (version 2) | Metagenome | Tenebrionidae |
| 15 | 3300057007 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP_oats (version 2) | Metagenome | Tenebrionidae |
| 16 | 8046957834 | Streptomyces coacervatus JCM 17138 | Isolate | Unclassified |
| 17 | 8109397740 | Rhodococcus triatomae DSM 44892 | Isolate | Unclassified |
| 18 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 19 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 20 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 21 | 3300012839 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG | Metagenome | Culicidae |
| 22 | 2523533511 | Streptomyces sp. Sv. ACTE SirexAA-E | Isolate | Siricidae |
| 23 | 2568526170 | Bifidobacterium sp. A11 | Isolate | Apidae |
| 24 | 2600255079 | Bifidobacterium bombi DSM 19703 | Isolate | Apidae |
| 25 | 2684622919 | Bifidobacterium asteroides Bi_199 | Isolate | Unclassified |
| 26 | 2731957681 | Xylanimicrobium pachnodae JCM 13526, NBRC 107786 | Isolate | Scarabaeidae |
| 27 | 2818991320 | Klugiella xanthotipulae DSM 18031 | Isolate | Unclassified |
| 28 | 2861945162 | Microbacterium sp. AR7-10 | Isolate | Culicidae |
| 29 | 2883683260 | Protaetiibacter larvae KACC 19322 | Isolate | Scarabaeidae |
| 30 | 2894900265 | Leucobacter sp. OLTLW20 | Isolate | Anthocoridae |
| 31 | 2894929448 | Leucobacter sp. OAMSW11 | Isolate | Anthocoridae |
| 32 | 2915168811 | Leucobacter sp. cx-169 | Isolate | Cambaridae |
| 33 | 8024986378 | Bifidobacterium asteroides ESL0198 | Isolate | Apidae |
| 34 | 8032009961 | Bifidobacterium indicum ESL0197 | Isolate | Apidae |
| 35 | 3002678670 | Agromyces sp. G127AT | Isolate | Unclassified |
| 36 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 37 | 3300012805 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E11 MG | Metagenome | |
| 38 | 2684622920 | Bifidobacterium asteroides Bi_200 | Isolate | Unclassified |
| 39 | 2802429577 | Bifidobacterium indicum DSM 20214 | Isolate | Unclassified |
| 40 | 2820809073 | Unclassified Actinobacteria Nt197P3bin55 | Isolate | Unclassified |
| 41 | 2841168549 | Agromyces protaetiae FW100M-8 | Isolate | Scarabaeidae |
| 42 | 2856954254 | Pseudonocardia sp. Ae505_Ps2 | Isolate | Formicidae |
| 43 | 2864918810 | Tsukamurella ocularis S00175 | Isolate | Elmidae |
| 44 | 2879643867 | Bifidobacterium sp. wkB344 | Isolate | Apidae |
| 45 | 2884351759 | Cellulosimicrobium sp. BI34T | Isolate | Pyralidae |
| 46 | 2894897082 | Leucobacter sp. OLCS4 | Isolate | Anthocoridae |
| 47 | 2894974975 | Leucobacter sp. OLIS6 | Isolate | Anthocoridae |
| 48 | 2900368070 | Nocardia aurantia RB56 | Isolate | Termitidae |
| 49 | 2912749649 | Streptomyces sp. GS7 | Isolate | Termitidae |
| 50 | 8062747827 | Yimella sp. cx-51 | Isolate | Cambaridae |
| 51 | 3006667155 | Streptomyces sp. SID9727 | Isolate | |
| 52 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 53 | 3300012806 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E1 MG | Metagenome | |
| 54 | 3300012809 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E11 MG | Metagenome | |
| 55 | 3300012858 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG | Metagenome | Armadillidiidae |
| 56 | 8110340172 | Bifidobacterium choladohabitans B14384H11 | Isolate | Apidae |
| 57 | 2515154100 | Streptomyces sp. MspMP-M5 | Isolate | Unclassified |
| 58 | 2515154104 | Streptomyces sp. KhCrAH-244 | Isolate | Unclassified |
| 59 | 2519899775 | Bifidobacterium asteroides PRL2011 | Isolate | Apidae |
| 60 | 2524023214 | Leucobacter chironomi DSM 19883 | Isolate | Chironomidae |
| 61 | 2597490239 | Bifidobacterium bohemicum DSM 22767 | Isolate | Unclassified |
| 62 | 2663763384 | Bifidobacterium bombi DSM 19703 | Isolate | Apidae |
| 63 | 2675903497 | Pseudonocardia sp. EC080610-09 | Isolate | Formicidae |
| 64 | 2681812870 | Oerskovia enterophila DFA-19 | Isolate | Unclassified |
| 65 | 2820909719 | Unclassified Actinobacteria Emb289P4bin20 | Isolate | Unclassified |
| 66 | 2821316722 | Unclassified Actinobacteria Lab288P1bin78 | Isolate | Unclassified |
| 67 | 2848356102 | Xylanimonas allomyrinae 2JSPR-7 | Isolate | Scarabaeidae |
| 68 | 2856966858 | Pseudonocardia sp. Ae263_Ps1 | Isolate | Formicidae |
| 69 | 2862075925 | Corynebacterium lactis S064 | Isolate | Ixodidae |
| 70 | 2894932631 | Leucobacter sp. OAMLP11 | Isolate | Anthocoridae |
| 71 | 2894966443 | Leucobacter sp. OLCALW19 | Isolate | Anthocoridae |
| 72 | 2896955351 | Streptomyces sp. GF20 | Isolate | Termitidae |
| 73 | 2910090113 | Kocuria sp. cx-116 | Isolate | Cambaridae |
| 74 | 647000328 | Streptomyces sp. ACT-1 XylebKG-1 | Isolate | Curculionidae |
| 75 | 649989992 | Pseudonocardia sp. P1 | Isolate | Formicidae |
| 76 | 8053361298 | Streptomyces formicae 1H-GS9 | Isolate | Unclassified |
| 77 | 8067987626 | Agromyces larvae CFWR-12 | Isolate | Unclassified |
| 78 | 8073544309 | Actinomadura sp. RB99 | Isolate | Termitidae |
| 79 | 3300000333 | Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony | Metagenome | Apidae |
| 80 | 2547132081 | Streptomyces sp. S4 | Isolate | Formicidae |
| 81 | 2660238275 | Bifidobacterium indicum DSM 20214 | Isolate | Unclassified |
| 82 | 2684622916 | Bifidobacterium asteroides Bi_170 | Isolate | Unclassified |
| 83 | 2684622917 | Bifidobacterium coryneforme Bi_197 | Isolate | Unclassified |
| 84 | 2693429521 | Bifidobacterium coryneforme DSM 20216 | Isolate | Unclassified |
| 85 | 2788500098 | Bombiscardovia coagulans DSM 22924 | Isolate | Apidae |
| 86 | 2816332114 | Microbacterium saperdae DSM 20169 | Isolate | Unclassified |
| 87 | 2820825283 | Unclassified Actinobacteria Nt197P3bin111 | Isolate | Unclassified |
| 88 | 2820894511 | Unclassified Actinobacteria Lab288P1bin103 | Isolate | Unclassified |
| 89 | 2883361506 | Luteimicrobium xylanilyticum HY-24 | Isolate | Cerambycidae |
| 90 | 2894935787 | Leucobacter sp. OLJS4 | Isolate | Anthocoridae |
| 91 | 2909881144 | Kocuria sp. cx-455 | Isolate | Cambaridae |
| 92 | 2918394494 | Microbacterium imperiale DSM 20530 | Isolate | Unclassified |
| 93 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 94 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
| 95 | 8024982947 | Bifidobacterium asteroides ESL0200 | Isolate | Apidae |
| 96 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 97 | 3300012825 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E1 MG | Metagenome | |
| 98 | 3300012848 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG | Metagenome | Armadillidiidae |
| 99 | 3300012861 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E0 MG | Metagenome | Culicidae |
| 100 | 8110341875 | Bifidobacterium polysaccharolyticum W8117 | Isolate | Apidae |
| 101 | 2515154106 | Streptomyces sp. FxanaD5 | Isolate | Unclassified |
| 102 | 2518645556 | Nocardiopsis alba ATCC BAA-2165 | Isolate | Apidae |
| 103 | 2547132042 | Pseudonocardia sp. P2 | Isolate | Formicidae |
| 104 | 2718217924 | Pseudonocardia sp. HH130630-07 | Isolate | Formicidae |
| 105 | 2772190761 | Rhodococcus rhodnii NRRL B-16535 | Isolate | Unclassified |
| 106 | 2808606957 | Bifidobacterium sp. ESL0447 | Isolate | Unclassified |
| 107 | 2820876581 | Unclassified Actinobacteria Lab288P1bin83 | Isolate | Unclassified |
| 108 | 2821314491 | Unclassified Actinobacteria Lab288P4bin49 | Isolate | Unclassified |
| 109 | 2856960404 | Pseudonocardia sp. Ae706_Ps2 | Isolate | Formicidae |
| 110 | 2856973192 | Pseudonocardia sp. Ae331_Ps2 | Isolate | Formicidae |
| 111 | 2859970369 | Pseudonocardia sp. Ae717_Ps2 | Isolate | Formicidae |
| 112 | 2862784999 | Streptomyces sp. M41 | Isolate | Unclassified |
| 113 | 2864773010 | Tsukamurella ocularis S00022 | Isolate | Elmidae |
| 114 | 2894981435 | Leucobacter sp. OLDS2 | Isolate | Anthocoridae |
| 115 | 2909412500 | Yimella sp. cx-573 | Isolate | Cambaridae |
| 116 | 2931425734 | Nocardioides sp. J2M5 | Isolate | |
| 117 | 2931430189 | Tessaracoccus palaemonis J1M15 | Isolate | |
| 118 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 119 | 3300012831 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E6 MG | Metagenome | Culicidae |
| 120 | 3300012850 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E0 MG | Metagenome | Culicidae |
| 121 | 2505679068 | Isoptericola variabilis 225 | Isolate | Unclassified |
| 122 | 2513237174 | Bifidobacterium asteroides ATCC 25910 | Isolate | Apidae |
| 123 | 2645727657 | Bifidobacterium actinocoloniiforme DSM 22766 | Isolate | Unclassified |
| 124 | 2671180625 | Pseudonocardia sp. EC080619-01 | Isolate | Formicidae |
| 125 | 2675903013 | Rhodococcus triatomae DSM 44892 | Isolate | Unclassified |
| 126 | 2820818506 | Unclassified Actinobacteria Nt197P3bin3 | Isolate | Unclassified |
| 127 | 2820845766 | Unclassified Actinobacteria Lab288P3bin96 | Isolate | Unclassified |
| 128 | 2820926697 | Unclassified Actinobacteria Emb289P3bin125 | Isolate | Unclassified |
| 129 | 2837204985 | Lysinimonas sp. 2DFWR-13 | Isolate | Scarabaeidae |
| 130 | 2865982043 | Bifidobacterium aemilianum XV10 | Isolate | Apidae |
| 131 | 2873586004 | Sanguibacter sp. HDW7 | Isolate | Hydrophilidae |
| 132 | 2894944011 | Leucobacter sp. OLAS13 | Isolate | Anthocoridae |
| 133 | 2915166107 | Leucobacter sp. cx-87 | Isolate | Cambaridae |
| 134 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 135 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 136 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 137 | 646564587 | Tsukamurella paurometabola 33, DSM 20162 | Isolate | Cimicidae |
| 138 | 8062637095 | Yimella sp. cx-51 | Isolate | Cambaridae |
| 139 | 8077775691 | Tsukamurella sp. PLM1 | Isolate | Formicidae |
| 140 | 8077783556 | Streptomyces sp. PLM4 | Isolate | Formicidae |
| 141 | 3300012818 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E0 MG | Metagenome | |
| 142 | 3300012834 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E6 MG | Metagenome | |
| 143 | 3300012857 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E0 MG | Metagenome | Culicidae |
| 144 | 8118075156 | Actinosynnema pretiosum DSM 44131 | Isolate | Unclassified |
| 145 | 2684622918 | Bifidobacterium asteroides Bi_198 | Isolate | Unclassified |
| 146 | 2820882373 | Unclassified Actinobacteria Lab288P1bin45 | Isolate | Unclassified |
| 147 | 2836973655 | Gryllotalpicola protaetiae 2DFW10M-5 | Isolate | Scarabaeidae |
| 148 | 2856671350 | Pseudonocardia sp. Ae356_Ps1 | Isolate | Formicidae |
| 149 | 2856947901 | Pseudonocardia sp. Ae168_Ps1 | Isolate | Formicidae |
| 150 | 2864899338 | Mycobacteroides chelonae S00154 | Isolate | Elmidae |
| 151 | 2873196663 | Streptomyces capitiformicae 1H-SSA4 | Isolate | Formicidae |
| 152 | 2908241010 | Streptomyces sp. HF10 | Isolate | Termitidae |
| 153 | 2912817845 | Streptomyces griseus SID164 | Isolate | |
| 154 | 2918390780 | Glutamicibacter protophormiae DSM 20168 | Isolate | Unclassified |
| 155 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 156 | 3300056790 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) | Metagenome | Tenebrionidae |
| 157 | 3300056856 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) | Metagenome | Tenebrionidae |
| 158 | 8024981139 | Bifidobacterium asteroides ESL0170 | Isolate | Apidae |
| 159 | 8024984606 | Bifidobacterium asteroides ESL0199 | Isolate | Apidae |
| 160 | 8030347546 | Propionimicrobium sp. PCR01-08-3 | Isolate | Tenebrionidae |
| 161 | 8069511479 | Arthrobacter ipsi IA7 | Isolate | Curculionidae |
| 162 | 3006468911 | Streptomyces sp. RB17 | Isolate | Termitidae |
| 163 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 164 | 3300012828 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E0 MG | Metagenome | |
| 165 | 3300012852 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E0 MG | Metagenome |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0562379_0889 | 3300056790 | Bacteria | 44628 |
| 2 | Ga0562375_0060 | 3300056856 | Unclassified | 442763 |
| 3 | Ga0123357_10025593 | 3300009784 | Bacteria | 7963 |
| 4 | Ga0160466_100807 | 3300012809 | Unclassified | 12133 |
| 5 | Ga0160452_100025 | 3300012834 | Bacteria | 245284 |
| 6 | Ga0160457_1000040 | 3300012858 | Bacteria | 212275 |
| 7 | JGI24705J35276_12231409 | 3300002504 | Bacteria | 3932 |
| 8 | Ga0123357_10000411 | 3300009784 | Bacteria | 40792 |
| 9 | Ga0466730_030357 | 3300042625 | Bacteria | 36821 |
| 10 | Ga0562375_3017 | 3300056856 | Bacteria | 16995 |
| 11 | Ga0123357_10013476 | 3300009784 | Bacteria | 10618 |
| 12 | Ga0123353_10423263 | 3300010167 | Bacteria | 1972 |
| 13 | Ga0160441_100800 | 3300012825 | Bacteria | 16099 |
| 14 | JGI24699J35502_11133588 | 3300002509 | Bacteria | 12293 |
| 15 | Ga0562376_0008 | 3300056857 | Bacteria | 1266359 |
| 16 | Ga0562374_0020 | 3300057007 | Bacteria | 1125244 |
| 17 | Ga0123355_10019589 | 3300009826 | Bacteria | 10775 |
| 18 | Ga0160441_100635 | 3300012825 | Bacteria | 21788 |
| 19 | Ga0160443_100135 | 3300012848 | Bacteria | 109555 |
| 20 | Ga0160430_100460 | 3300012852 | Bacteria | 23561 |
| 21 | Ga0160430_101037 | 3300012852 | Unclassified | 11637 |
| 22 | Ga0160435_1001517 | 3300012857 | Bacteria | 5866 |
| 23 | Ga0466693_258072 | 3300042592 | Bacteria | 38272 |
| 24 | AustNasuHG_c1009146 | 3300000089 | Bacteria | 3485 |
| 25 | Ga0466734_020023 | 3300042623 | Bacteria | 1555 |
| 26 | Ga0466730_041023 | 3300042625 | Bacteria | 6317 |
| 27 | Ga0466724_46140 | 3300042649 | Bacteria | 630192 |
| 28 | Ga0562377_2421 | 3300056842 | Unclassified | 14024 |
| 29 | Ga0123356_10003211 | 3300010049 | Bacteria | 17169 |
| 30 | Ga0123354_10206462 | 3300010882 | Bacteria | 2139 |
| 31 | Ga0160442_100228 | 3300012806 | Bacteria | 42933 |
| 32 | Ga0160431_106024 | 3300012828 | Unclassified | 1910 |
| 33 | Ga0160443_100020 | 3300012848 | Bacteria | 410950 |
| 34 | Ga0160434_100007 | 3300012850 | Bacteria | 314941 |
| 35 | Ga0160430_101684 | 3300012852 | Bacteria | 7857 |
| 36 | Ga0466706_196894 | 3300042599 | Bacteria | 81884 |
| 37 | Ga0466730_033567 | 3300042625 | Bacteria | 12083 |
| 38 | Ga0466724_03840 | 3300042649 | Bacteria | 216199 |
| 39 | Ga0562378_0005 | 3300056814 | Bacteria | 1949920 |
| 40 | Ga0123357_10089795 | 3300009784 | Bacteria | 4010 |
| 41 | Ga0160457_1000016 | 3300012858 | Bacteria | 412496 |
| 42 | Ga0466718_126767 | 3300042617 | Bacteria | 15103 |
| 43 | Ga0123357_10005495 | 3300009784 | Bacteria | 15199 |
| 44 | Ga0123357_10254657 | 3300009784 | Bacteria | 1870 |
| 45 | Ga0123356_10000166 | 3300010049 | Bacteria | 74200 |
| 46 | Ga0160432_100975 | 3300012818 | Bacteria | 11635 |
| 47 | Ga0160452_100255 | 3300012834 | Bacteria | 52127 |
| 48 | Ga0160472_100077 | 3300012839 | Bacteria | 162746 |
| 49 | Ga0160435_1004997 | 3300012857 | Bacteria | 3035 |
| 50 | Ga0466693_323082 | 3300042592 | Bacteria | 4352 |
| 51 | Ga0466718_085787 | 3300042617 | Bacteria | 3625 |
| 52 | HBC_ctgsDRAFT_1003710 | 3300000333 | Unclassified | 3508 |
| 53 | Ga0466724_66575 | 3300042649 | Bacteria | 3552 |
| 54 | Ga0466697_266787 | 3300042611 | Bacteria | 12491 |
| 55 | Ga0123354_10000205 | 3300010882 | Bacteria | 51424 |
| 56 | Ga0160459_100257 | 3300012831 | Bacteria | 26511 |
| 57 | Ga0160464_101817 | 3300012805 | Unclassified | 5524 |
| 58 | Ga0160452_103212 | 3300012834 | Bacteria | 2986 |
| 59 | Ga0160435_1000076 | 3300012857 | Bacteria | 60641 |
| 60 | Ga0160436_1000022 | 3300012861 | Bacteria | 101785 |
| 61 | Ga0160436_1000230 | 3300012861 | Bacteria | 27009 |
| 62 | JGI24699J35502_11121161 | 3300002509 | Bacteria | 3314 |
| 63 | Ga0466730_082491 | 3300042625 | Bacteria | 13140 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.