Protein Family IF13917
Metagenome
Isolate
274
Members
166
Samples
181
Scaffolds
183.62
Avg Length
Representative Sequence
- ID
- iso_pr_bacteria|8053361298|8053361824|
- Length
- 213 aa
- Sequence
- MADWSFGKAEPAEPVAGKRAEKPRQKATRVNEKDMGADLKSVLITKEEIDAKLAELAAKIDAEYAGKDLLIVGVLKGAVMAMADLARALSTPVTMDWMAVSSYGAGTQSSGVVRILKDLDTDIKGKHVLIVEDIIDSGLTLSWLLSNLGSREPASLEVCTLLRKPDAAKVAIDVKWIGFDIPNEFVVGYGLDYAEKYRNLPFVGTLAPHVYGG
Sample Types
Isolate
33.9%
Metagenome
66.1%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Unclassified
28.8%
Termitidae
19.0%
Anthocoridae
6.5%
Kalotermitidae
6.5%
Scarabaeidae
5.9%
Cambaridae
4.6%
Tenebrionidae
4.6%
Culicidae
4.6%
Armadillidiidae
4.6%
Formicidae
2.6%
Termopsidae
2.0%
Rhinotermitidae
1.3%
Curculionidae
1.3%
Drosophilidae
1.3%
Cerambycidae
1.3%
Chironomidae
0.7%
Hodotermitidae
0.7%
Passalidae
0.7%
Pyralidae
0.7%
Siricidae
0.7%
Dytiscidae
0.7%
Apidae
0.7%
Hydrophilidae
0.7%
Taxonomy
Archaea
0
Bacteria
251
Eukaryota
0
Viruses
0
Unclassified
23
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2515154100 | Streptomyces sp. MspMP-M5 | Isolate | Unclassified |
| 2 | 2515154104 | Streptomyces sp. KhCrAH-244 | Isolate | Unclassified |
| 3 | 2524023214 | Leucobacter chironomi DSM 19883 | Isolate | Chironomidae |
| 4 | 2820909719 | Unclassified Actinobacteria Emb289P4bin20 | Isolate | Unclassified |
| 5 | 2821316722 | Unclassified Actinobacteria Lab288P1bin78 | Isolate | Unclassified |
| 6 | 2848356102 | Xylanimonas allomyrinae 2JSPR-7 | Isolate | Scarabaeidae |
| 7 | 2894932631 | Leucobacter sp. OAMLP11 | Isolate | Anthocoridae |
| 8 | 2894966443 | Leucobacter sp. OLCALW19 | Isolate | Anthocoridae |
| 9 | 2896955351 | Streptomyces sp. GF20 | Isolate | Termitidae |
| 10 | 2910090113 | Kocuria sp. cx-116 | Isolate | Cambaridae |
| 11 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 12 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 13 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 14 | 647000328 | Streptomyces sp. ACT-1 XylebKG-1 | Isolate | Curculionidae |
| 15 | 8053361298 | Streptomyces formicae 1H-GS9 | Isolate | Unclassified |
| 16 | 8067987626 | Agromyces larvae CFWR-12 | Isolate | Unclassified |
| 17 | 8073544309 | Actinomadura sp. RB99 | Isolate | Termitidae |
| 18 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 19 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 20 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 21 | 2504756063 | Isoptericola variabilis J5 | Isolate | Unclassified |
| 22 | 2648501322 | Streptomyces sp. SA3_actF | Isolate | Unclassified |
| 23 | 2734481968 | Xylanimicrobium pachnodae JCM 13526, NBRC 107786 | Isolate | Scarabaeidae |
| 24 | 2820814774 | Unclassified Actinobacteria Nt197P3bin39 | Isolate | Unclassified |
| 25 | 2820816657 | Unclassified Actinobacteria Nt197P3bin38 | Isolate | Unclassified |
| 26 | 2820944107 | Unclassified Actinobacteria Cu122P5bin14 | Isolate | Unclassified |
| 27 | 2884613238 | Agromyces intestinalis KACC 19306 | Isolate | Scarabaeidae |
| 28 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 29 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 30 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 31 | 3300056814 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE (version 2) | Metagenome | Tenebrionidae |
| 32 | 3300056857 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS (version 2) | Metagenome | Tenebrionidae |
| 33 | 3300057007 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP_oats (version 2) | Metagenome | Tenebrionidae |
| 34 | 8046957834 | Streptomyces coacervatus JCM 17138 | Isolate | Unclassified |
| 35 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 36 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 37 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 38 | 3300000036 | Passalidae beetle gut microbial communities from Costa Rica - Gallery material (4MSU+4BSU+3MSU+3BSU) | Metagenome | Passalidae |
| 39 | 3300007153 | Drosophila gut microbial communities from New York, USA - Drosophila putrida male 3 gut | Metagenome | Drosophilidae |
| 40 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 41 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 42 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 43 | 3300012839 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG | Metagenome | Culicidae |
| 44 | 2841168549 | Agromyces protaetiae FW100M-8 | Isolate | Scarabaeidae |
| 45 | 2884351759 | Cellulosimicrobium sp. BI34T | Isolate | Pyralidae |
| 46 | 2894897082 | Leucobacter sp. OLCS4 | Isolate | Anthocoridae |
| 47 | 2894974975 | Leucobacter sp. OLIS6 | Isolate | Anthocoridae |
| 48 | 2912749649 | Streptomyces sp. GS7 | Isolate | Termitidae |
| 49 | 8062747827 | Yimella sp. cx-51 | Isolate | Cambaridae |
| 50 | 3006461590 | Streptomyces sp. RB5 | Isolate | Termitidae |
| 51 | 3006667155 | Streptomyces sp. SID9727 | Isolate | |
| 52 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 53 | 3300012806 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E1 MG | Metagenome | |
| 54 | 3300012809 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E11 MG | Metagenome | |
| 55 | 3300012819 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E11 MG | Metagenome | Armadillidiidae |
| 56 | 3300012858 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG | Metagenome | Armadillidiidae |
| 57 | 2523533511 | Streptomyces sp. Sv. ACTE SirexAA-E | Isolate | Siricidae |
| 58 | 2731957681 | Xylanimicrobium pachnodae JCM 13526, NBRC 107786 | Isolate | Scarabaeidae |
| 59 | 2818991320 | Klugiella xanthotipulae DSM 18031 | Isolate | Unclassified |
| 60 | 2820857933 | Unclassified Actinobacteria Lab288P3bin173 | Isolate | Unclassified |
| 61 | 2820863028 | Unclassified Actinobacteria Lab288P3bin164 | Isolate | Unclassified |
| 62 | 2820899690 | Unclassified Actinobacteria Emb289P4bin9 | Isolate | Unclassified |
| 63 | 2873617540 | Leucobacter insecticola HDW9B | Isolate | Dytiscidae |
| 64 | 2883683260 | Protaetiibacter larvae KACC 19322 | Isolate | Scarabaeidae |
| 65 | 2894900265 | Leucobacter sp. OLTLW20 | Isolate | Anthocoridae |
| 66 | 2894929448 | Leucobacter sp. OAMSW11 | Isolate | Anthocoridae |
| 67 | 2898589227 | Actinomadura macrotermitis RB68 | Isolate | Termitidae |
| 68 | 2915168811 | Leucobacter sp. cx-169 | Isolate | Cambaridae |
| 69 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 70 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 71 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 72 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 73 | 3002678670 | Agromyces sp. G127AT | Isolate | Unclassified |
| 74 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 75 | 3300012805 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E11 MG | Metagenome | |
| 76 | 3300012814 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E6 MG | Metagenome | |
| 77 | 2084038013 | Anoplophora glabripennis gut microbial communities from Worchester, Massachusetts, USA - Larvae | Metagenome | Cerambycidae |
| 78 | 2515154106 | Streptomyces sp. FxanaD5 | Isolate | Unclassified |
| 79 | 2518645556 | Nocardiopsis alba ATCC BAA-2165 | Isolate | Apidae |
| 80 | 2820803007 | Unclassified Actinobacteria Th196P3bin61 | Isolate | Unclassified |
| 81 | 2820842553 | Unclassified Actinobacteria Lab288P4bin104 | Isolate | Unclassified |
| 82 | 2820929059 | Unclassified Actinobacteria Emb289P3bin110 | Isolate | Unclassified |
| 83 | 2821314491 | Unclassified Actinobacteria Lab288P4bin49 | Isolate | Unclassified |
| 84 | 2847305884 | Microbacterium protaetiae DFW100M-13 | Isolate | Scarabaeidae |
| 85 | 2862784999 | Streptomyces sp. M41 | Isolate | Unclassified |
| 86 | 2894981435 | Leucobacter sp. OLDS2 | Isolate | Anthocoridae |
| 87 | 2909412500 | Yimella sp. cx-573 | Isolate | Cambaridae |
| 88 | 2931425734 | Nocardioides sp. J2M5 | Isolate | |
| 89 | 2931430189 | Tessaracoccus palaemonis J1M15 | Isolate | |
| 90 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 91 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 92 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 93 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 94 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 95 | 3300012824 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E11 MG | Metagenome | Armadillidiidae |
| 96 | 3300012831 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E6 MG | Metagenome | Culicidae |
| 97 | 3300012837 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E6 MG | Metagenome | Armadillidiidae |
| 98 | 3300012849 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG | Metagenome | Culicidae |
| 99 | 3300012850 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E0 MG | Metagenome | Culicidae |
| 100 | 3300012854 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E1 MG | Metagenome | Culicidae |
| 101 | 2505679068 | Isoptericola variabilis 225 | Isolate | Unclassified |
| 102 | 2820807258 | Unclassified Actinobacteria Nt197P3bin90 | Isolate | Unclassified |
| 103 | 2820818506 | Unclassified Actinobacteria Nt197P3bin3 | Isolate | Unclassified |
| 104 | 2820845766 | Unclassified Actinobacteria Lab288P3bin96 | Isolate | Unclassified |
| 105 | 2820849606 | Unclassified Actinobacteria Lab288P3bin39 | Isolate | Unclassified |
| 106 | 2820922474 | Unclassified Actinobacteria Emb289P3bin154 | Isolate | Unclassified |
| 107 | 2820926697 | Unclassified Actinobacteria Emb289P3bin125 | Isolate | Unclassified |
| 108 | 2837204985 | Lysinimonas sp. 2DFWR-13 | Isolate | Scarabaeidae |
| 109 | 2873586004 | Sanguibacter sp. HDW7 | Isolate | Hydrophilidae |
| 110 | 2894944011 | Leucobacter sp. OLAS13 | Isolate | Anthocoridae |
| 111 | 2915166107 | Leucobacter sp. cx-87 | Isolate | Cambaridae |
| 112 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 113 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 114 | 8062637095 | Yimella sp. cx-51 | Isolate | Cambaridae |
| 115 | 8077783556 | Streptomyces sp. PLM4 | Isolate | Formicidae |
| 116 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 117 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 118 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 119 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 120 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 121 | 3300012818 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E0 MG | Metagenome | |
| 122 | 3300012834 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E6 MG | Metagenome | |
| 123 | 3300012846 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG | Metagenome | Armadillidiidae |
| 124 | 2820820509 | Unclassified Actinobacteria Nt197P3bin23 | Isolate | Unclassified |
| 125 | 2820882373 | Unclassified Actinobacteria Lab288P1bin45 | Isolate | Unclassified |
| 126 | 2820897376 | Unclassified Actinobacteria Lab288P1bin101 | Isolate | Unclassified |
| 127 | 2836973655 | Gryllotalpicola protaetiae 2DFW10M-5 | Isolate | Scarabaeidae |
| 128 | 2856652821 | Actinomadura rubteroloni RB29 | Isolate | Unclassified |
| 129 | 2873196663 | Streptomyces capitiformicae 1H-SSA4 | Isolate | Formicidae |
| 130 | 2894926108 | Leucobacter sp. OLES1 | Isolate | Anthocoridae |
| 131 | 2908241010 | Streptomyces sp. HF10 | Isolate | Termitidae |
| 132 | 2912817845 | Streptomyces griseus SID164 | Isolate | |
| 133 | 2918390780 | Glutamicibacter protophormiae DSM 20168 | Isolate | Unclassified |
| 134 | 3300056790 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) | Metagenome | Tenebrionidae |
| 135 | 3300056856 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) | Metagenome | Tenebrionidae |
| 136 | 8030347546 | Propionimicrobium sp. PCR01-08-3 | Isolate | Tenebrionidae |
| 137 | 8069511479 | Arthrobacter ipsi IA7 | Isolate | Curculionidae |
| 138 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 139 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 140 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 141 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 142 | 3006468911 | Streptomyces sp. RB17 | Isolate | Termitidae |
| 143 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 144 | 3300012828 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E0 MG | Metagenome | |
| 145 | 3300012847 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG | Metagenome | Armadillidiidae |
| 146 | 3300012852 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E0 MG | Metagenome | |
| 147 | 2547132081 | Streptomyces sp. S4 | Isolate | Formicidae |
| 148 | 2816332114 | Microbacterium saperdae DSM 20169 | Isolate | Unclassified |
| 149 | 2820825283 | Unclassified Actinobacteria Nt197P3bin111 | Isolate | Unclassified |
| 150 | 2820829137 | Unclassified Actinobacteria Nc150P5bin2 | Isolate | Unclassified |
| 151 | 2820894511 | Unclassified Actinobacteria Lab288P1bin103 | Isolate | Unclassified |
| 152 | 2820911766 | Unclassified Actinobacteria Emb289P3bin96 | Isolate | Unclassified |
| 153 | 2883361506 | Luteimicrobium xylanilyticum HY-24 | Isolate | Cerambycidae |
| 154 | 2894935787 | Leucobacter sp. OLJS4 | Isolate | Anthocoridae |
| 155 | 2909881144 | Kocuria sp. cx-455 | Isolate | Cambaridae |
| 156 | 2918394494 | Microbacterium imperiale DSM 20530 | Isolate | Unclassified |
| 157 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 158 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
| 159 | 8012935351 | Brevibacterium epidermidis UD i117 | Isolate | Unclassified |
| 160 | 8067071256 | Microbispora camponoti 2C-HV3 | Isolate | Formicidae |
| 161 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 162 | 3300012820 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E6 MG | Metagenome | Armadillidiidae |
| 163 | 3300012825 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E1 MG | Metagenome | |
| 164 | 3300012845 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E6 MG | Metagenome | Culicidae |
| 165 | 3300012861 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E0 MG | Metagenome | Culicidae |
| 166 | 3300007136 | Drosophila gut microbial communities from New York, USA - Drosophila neotestacea female 4 gut | Metagenome | Drosophilidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_095557 | 3300042612 | Bacteria | 2246 |
| 2 | Ga0466705_196024 | 3300042612 | Unclassified | 21022 |
| 3 | Ga0562375_1637 | 3300056856 | Bacteria | 29049 |
| 4 | Ga0562375_1988 | 3300056856 | Bacteria | 24749 |
| 5 | Ga0072940_1089046 | 3300005200 | Bacteria | 8910 |
| 6 | Ga0466705_523513 | 3300042612 | Bacteria | 5576 |
| 7 | Ga0466723_014435 | 3300042618 | Bacteria | 11775 |
| 8 | Ga0466723_164711 | 3300042618 | Bacteria | 2866 |
| 9 | Ga0123357_10099391 | 3300009784 | Unclassified | 3757 |
| 10 | Ga0123356_10000546 | 3300010049 | Bacteria | 41728 |
| 11 | Ga0123356_10044312 | 3300010049 | Bacteria | 4142 |
| 12 | Ga0123356_10514686 | 3300010049 | Bacteria | 1354 |
| 13 | Ga0123353_10037513 | 3300010167 | Unclassified | 7604 |
| 14 | Ga0123353_10880400 | 3300010167 | Bacteria | 1222 |
| 15 | Ga0123354_10133430 | 3300010882 | Bacteria | 3121 |
| 16 | Ga0466729_278460 | 3300042621 | Bacteria | 2717 |
| 17 | Ga0466734_093996 | 3300042623 | Bacteria | 7470 |
| 18 | Ga0466730_033870 | 3300042625 | Bacteria | 2787 |
| 19 | Ga0466730_071485 | 3300042625 | Bacteria | 1178 |
| 20 | Ga0466703_166237 | 3300042636 | Bacteria | 199031 |
| 21 | Ga0160468_104745 | 3300012819 | Bacteria | 1604 |
| 22 | Ga0160452_100003 | 3300012834 | Bacteria | 748778 |
| 23 | Ga0160447_118089 | 3300012849 | Unclassified | 1209 |
| 24 | Ga0160434_124001 | 3300012850 | Unclassified | 907 |
| 25 | Ga0160430_111139 | 3300012852 | Bacteria | 1514 |
| 26 | Ga0466657_119452 | 3300042582 | Bacteria | 1321 |
| 27 | Ga0466696_417724 | 3300042596 | Bacteria | 18755 |
| 28 | Ga0466713_029449 | 3300042602 | Bacteria | 6113 |
| 29 | Ga0466722_174934 | 3300042609 | Bacteria | 1280 |
| 30 | Ga0562377_0572 | 3300056842 | Bacteria | 56438 |
| 31 | AustNasuHG_c1016278 | 3300000089 | Bacteria | 2490 |
| 32 | JGI24699J35502_10906792 | 3300002509 | Bacteria | 1061 |
| 33 | JGI24699J35502_11131411 | 3300002509 | Unclassified | 5690 |
| 34 | Ga0072940_1120330 | 3300005200 | Bacteria | 1623 |
| 35 | Ga0104050_1026211 | 3300007153 | Bacteria | 5448 |
| 36 | Ga0466715_275826 | 3300042616 | Bacteria | 110585 |
| 37 | Ga0466729_048868 | 3300042621 | Bacteria | 1015 |
| 38 | Ga0123357_10025276 | 3300009784 | Bacteria | 8008 |
| 39 | Ga0123357_10026801 | 3300009784 | Unclassified | 7784 |
| 40 | Ga0123357_10112181 | 3300009784 | Bacteria | 3471 |
| 41 | Ga0123357_10176520 | 3300009784 | Unclassified | 2510 |
| 42 | Ga0123353_10390354 | 3300010167 | Bacteria | 2077 |
| 43 | Ga0123353_10540029 | 3300010167 | Bacteria | 1685 |
| 44 | Ga0123354_10017504 | 3300010882 | Bacteria | 11226 |
| 45 | Ga0160464_102015 | 3300012805 | Unclassified | 4557 |
| 46 | Ga0466730_011085 | 3300042625 | Bacteria | 8544 |
| 47 | Ga0466730_054083 | 3300042625 | Bacteria | 1601 |
| 48 | Ga0466730_079471 | 3300042625 | Bacteria | 23781 |
| 49 | Ga0466724_02909 | 3300042649 | Bacteria | 7990 |
| 50 | Ga0466708_276381 | 3300042652 | Bacteria | 1647 |
| 51 | Ga0466725_349340 | 3300042654 | Bacteria | 1747 |
| 52 | Ga0160441_100399 | 3300012825 | Bacteria | 36291 |
| 53 | Ga0160430_100829 | 3300012852 | Unclassified | 14335 |
| 54 | Ga0160457_1000020 | 3300012858 | Bacteria | 357225 |
| 55 | Ga0160457_1000421 | 3300012858 | Unclassified | 21237 |
| 56 | Ga0466693_196387 | 3300042592 | Bacteria | 116150 |
| 57 | Ga0466707_042536 | 3300042601 | Bacteria | 80410 |
| 58 | Ga0466707_230842 | 3300042601 | Bacteria | 4510 |
| 59 | Ga0466707_407643 | 3300042601 | Bacteria | 5411 |
| 60 | Ga0466717_158674 | 3300042604 | Bacteria | 2926 |
| 61 | Ga0466719_438445 | 3300042606 | Bacteria | 11912 |
| 62 | Ga0466697_113414 | 3300042611 | Bacteria | 1107 |
| 63 | Ga0562377_2540 | 3300056842 | Unclassified | 13261 |
| 64 | Ga0466715_223939 | 3300042616 | Bacteria | 4665 |
| 65 | Ga0466723_329143 | 3300042618 | Bacteria | 4170 |
| 66 | Ga0466726_469196 | 3300042619 | Bacteria | 3705 |
| 67 | Ga0123357_10008085 | 3300009784 | Bacteria | 13102 |
| 68 | Ga0123357_10041671 | 3300009784 | Bacteria | 6244 |
| 69 | Ga0123357_10225055 | 3300009784 | Unclassified | 2071 |
| 70 | Ga0123355_10359086 | 3300009826 | Bacteria | 1921 |
| 71 | Ga0123356_10002234 | 3300010049 | Bacteria | 20856 |
| 72 | Ga0123356_10013228 | 3300010049 | Bacteria | 7980 |
| 73 | Ga0123356_10129435 | 3300010049 | Bacteria | 2470 |
| 74 | Ga0466727_034978 | 3300042655 | Bacteria | 6415 |
| 75 | Ga0160459_101822 | 3300012831 | Bacteria | 4009 |
| 76 | Ga0160455_106202 | 3300012837 | Bacteria | 1231 |
| 77 | Ga0160434_100100 | 3300012850 | Bacteria | 51512 |
| 78 | Ga0160448_132648 | 3300012854 | Bacteria | 744 |
| 79 | Ga0466706_150560 | 3300042599 | Bacteria | 2351 |
| 80 | Ga0466706_201885 | 3300042599 | Bacteria | 2135 |
| 81 | Ga0466733_100922 | 3300042659 | Bacteria | 12076 |
| 82 | Ga0562378_0289 | 3300056814 | Bacteria | 106334 |
| 83 | Ga0562375_0730 | 3300056856 | Bacteria | 58171 |
| 84 | Ga0562374_0036 | 3300057007 | Bacteria | 691317 |
| 85 | IMNBGM34_c007578 | 3300000036 | Bacteria | 1396 |
| 86 | Ga0466726_212516 | 3300042619 | Bacteria | 1787 |
| 87 | Ga0466728_403945 | 3300042620 | Bacteria | 1509 |
| 88 | Ga0123355_10516553 | 3300009826 | Unclassified | 1464 |
| 89 | Ga0123356_11942830 | 3300010049 | Bacteria | 733 |
| 90 | Ga0123353_10751898 | 3300010167 | Bacteria | 1357 |
| 91 | Ga0466730_098553 | 3300042625 | Bacteria | 33437 |
| 92 | Ga0160472_100027 | 3300012839 | Bacteria | 303331 |
| 93 | Ga0160460_103010 | 3300012845 | Bacteria | 3248 |
| 94 | Ga0160434_101161 | 3300012850 | Bacteria | 5209 |
| 95 | Ga0466705_063604 | 3300042612 | Bacteria | 3393 |
| 96 | Ga0562379_0554 | 3300056790 | Unclassified | 70465 |
| 97 | Ga0562376_0708 | 3300056857 | Unclassified | 55285 |
| 98 | Ga0562374_0086 | 3300057007 | Bacteria | 275839 |
| 99 | Ga0466718_083219 | 3300042617 | Bacteria | 1425 |
| 100 | Ga0466723_270244 | 3300042618 | Bacteria | 21838 |
| 101 | Ga0123356_10389967 | 3300010049 | Bacteria | 1528 |
| 102 | Ga0123353_10079654 | 3300010167 | Bacteria | 5267 |
| 103 | Ga0123354_10125172 | 3300010882 | Unclassified | 3288 |
| 104 | Ga0160442_100039 | 3300012806 | Bacteria | 223406 |
| 105 | Ga0160466_104374 | 3300012809 | Unclassified | 2056 |
| 106 | Ga0466734_034323 | 3300042623 | Bacteria | 1414 |
| 107 | Ga0466734_098547 | 3300042623 | Bacteria | 1167 |
| 108 | Ga0466730_066676 | 3300042625 | Unclassified | 6213 |
| 109 | Ga0466703_417190 | 3300042636 | Bacteria | 3208 |
| 110 | Ga0160431_104616 | 3300012828 | Bacteria | 2488 |
| 111 | Ga0466696_086896 | 3300042596 | Bacteria | 2694 |
| 112 | Ga0466701_046678 | 3300042598 | Bacteria | 1961 |
| 113 | Ga0466698_435058 | 3300042610 | Bacteria | 2765 |
| 114 | Ga0466697_183553 | 3300042611 | Bacteria | 8562 |
| 115 | Ga0562378_0264 | 3300056814 | Bacteria | 118501 |
| 116 | AglaG_contig05850 | 2084038013 | Bacteria | 1604 |
| 117 | Ga0466728_422472 | 3300042620 | Bacteria | 4023 |
| 118 | Ga0123356_10000177 | 3300010049 | Bacteria | 72517 |
| 119 | Ga0123356_10009109 | 3300010049 | Bacteria | 9817 |
| 120 | Ga0123356_10019010 | 3300010049 | Unclassified | 6519 |
| 121 | Ga0123353_10002139 | 3300010167 | Bacteria | 24442 |
| 122 | Ga0123353_10011256 | 3300010167 | Bacteria | 12587 |
| 123 | Ga0123354_10678832 | 3300010882 | Bacteria | 727 |
| 124 | Ga0466734_114496 | 3300042623 | Bacteria | 1395 |
| 125 | Ga0466704_203907 | 3300042643 | Bacteria | 14038 |
| 126 | Ga0160453_101708 | 3300012814 | Bacteria | 6751 |
| 127 | Ga0160452_102084 | 3300012834 | Bacteria | 4642 |
| 128 | Ga0160445_104713 | 3300012847 | Bacteria | 2446 |
| 129 | Ga0466707_098536 | 3300042601 | Bacteria | 5388 |
| 130 | Ga0466714_010797 | 3300042603 | Bacteria | 1132 |
| 131 | Ga0466705_216835 | 3300042612 | Bacteria | 10075 |
| 132 | Ga0466733_222417 | 3300042659 | Bacteria | 66821 |
| 133 | Ga0562379_0066 | 3300056790 | Bacteria | 440869 |
| 134 | Ga0562375_0164 | 3300056856 | Bacteria | 195314 |
| 135 | Ga0562375_0257 | 3300056856 | Bacteria | 143062 |
| 136 | Ga0072940_1219804 | 3300005200 | Bacteria | 1459 |
| 137 | Ga0123357_10119277 | 3300009784 | Bacteria | 3330 |
| 138 | Ga0123356_10000103 | 3300010049 | Bacteria | 89939 |
| 139 | Ga0123356_10002103 | 3300010049 | Bacteria | 21480 |
| 140 | Ga0123356_10169380 | 3300010049 | Bacteria | 2193 |
| 141 | Ga0123354_10182316 | 3300010882 | Bacteria | 2391 |
| 142 | Ga0123354_10346142 | 3300010882 | Bacteria | 1332 |
| 143 | Ga0466730_093979 | 3300042625 | Bacteria | 1219 |
| 144 | Ga0160469_101701 | 3300012824 | Bacteria | 5285 |
| 145 | Ga0160460_100996 | 3300012845 | Bacteria | 11787 |
| 146 | Ga0160447_100798 | 3300012849 | Bacteria | 13549 |
| 147 | Ga0160448_102271 | 3300012854 | Bacteria | 5991 |
| 148 | Ga0466691_219955 | 3300042593 | Bacteria | 9256 |
| 149 | Ga0466696_190426 | 3300042596 | Bacteria | 2050 |
| 150 | Ga0466696_447660 | 3300042596 | Bacteria | 16462 |
| 151 | Ga0466706_054554 | 3300042599 | Bacteria | 5354 |
| 152 | Ga0466713_075480 | 3300042602 | Bacteria | 45549 |
| 153 | Ga0466717_161258 | 3300042604 | Unclassified | 2398 |
| 154 | Ga0466733_113729 | 3300042659 | Bacteria | 1328 |
| 155 | Ga0562379_0201 | 3300056790 | Bacteria | 170713 |
| 156 | Ga0562374_0003 | 3300057007 | Bacteria | 3497630 |
| 157 | Ga0562374_1541 | 3300057007 | Bacteria | 26408 |
| 158 | JGI24705J35276_12056574 | 3300002504 | Bacteria | 928 |
| 159 | JGI24699J35502_11130257 | 3300002509 | Bacteria | 5024 |
| 160 | Ga0068302_10082945 | 3300005071 | Bacteria | 1622 |
| 161 | Ga0104044_1023862 | 3300007136 | Bacteria | 845 |
| 162 | Ga0466718_008776 | 3300042617 | Bacteria | 2439 |
| 163 | Ga0123357_10056370 | 3300009784 | Bacteria | 5285 |
| 164 | Ga0123357_10170335 | 3300009784 | Bacteria | 2578 |
| 165 | Ga0123356_10002793 | 3300010049 | Bacteria | 18511 |
| 166 | Ga0123353_10561892 | 3300010167 | Bacteria | 1642 |
| 167 | Ga0466730_041503 | 3300042625 | Bacteria | 2016 |
| 168 | Ga0466730_057187 | 3300042625 | Bacteria | 2035 |
| 169 | Ga0466703_019403 | 3300042636 | Bacteria | 92429 |
| 170 | Ga0466704_458176 | 3300042643 | Bacteria | 12336 |
| 171 | Ga0466724_32113 | 3300042649 | Bacteria | 125743 |
| 172 | Ga0160453_103694 | 3300012814 | Unclassified | 3069 |
| 173 | Ga0160432_100226 | 3300012818 | Bacteria | 48495 |
| 174 | Ga0160456_101451 | 3300012820 | Bacteria | 5518 |
| 175 | Ga0160433_104588 | 3300012846 | Bacteria | 2204 |
| 176 | Ga0160436_1000258 | 3300012861 | Unclassified | 24660 |
| 177 | Ga0466657_332895 | 3300042582 | Bacteria | 5495 |
| 178 | Ga0466701_101576 | 3300042598 | Bacteria | 1243 |
| 179 | Ga0466707_149168 | 3300042601 | Bacteria | 19844 |
| 180 | Ga0466713_035619 | 3300042602 | Bacteria | 5519 |
| 181 | Ga0466713_051074 | 3300042602 | Bacteria | 13286 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00156 | Pribosyltran | Phosphoribosyl transferase domain | 48 | 193 | 0.94 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.