Protein Family IF13714

Metagenome Isolate
303 Members
276 Samples
71 Scaffolds
668.38 Avg Length

🧬 Representative Sequence

ID
iso_pr_bacteria|8022345672|8022348259|
Length
716 aa
Sequence
MVSFPRNSYNPYQHIASNHKMIDFMTSITNAELEWNESGTPVSDQFDDVYFSNVNGLEETRYVFLKQNHLPERWLEHDQRRFVIAETGFGTGLNFLAVWQWFDAFLKDNPQAITKELHFISFEKYPLNKEDLIKAHQAWPELAEYATQLQEHYPIALPECHRIVLGDGTITLDLWFGDIKDCMPSVPTPKKGLVDAWFLDGFAPSKNPEMWNQNLFNGMAKLAKQDCSCATFTAAGFVRRGLIEAGFEMKKVKGFGTKREMIAGRLGEKHAHTNIKPWYGLSEHSDSQDIAIIGGGVASAALAKTLSRRGKNITLYCEHPQAAGNASGNNQGAIYPLLSEATSNVSRIFGPGLLFARQFINQAAKSIEFDHNWCGVNILMWDEGSTKKLNRMLEGNFHTDLIQRLSPEQANEKVGLPVDKESVYFPLGGWLSPLQLTQRLIGQLEETNKVSTHYQHQVTQLEWLEAEQQWQLTIETPRGEIQTKHDQVVVANGHKFTQFEQTQPVPLTPVKGQVSHIPTTENLNKLKTVLCFDGYLTPQNPNNGHHCIGANYDKTNIDQEFDIEVQQHNGERLHGSLPDQEWTKEVDTSGNLARQGIRSVSRDHLPFVGNVGDFEAIKEQYQNLHNFNPQRDSVDDVQTVTSFPNLFCFIGLGSRGLSSAPLLAEVLASQICGDPLPLPADVLEAIHPSRMWVRRLRKGKALTAGWVADKQANANQ

📊 Sample Types

Isolate 76.6%
Metagenome 23.4%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Unclassified 36.9%
Anthocoridae 8.1%
Drosophilidae 7.7%
Muscidae 4.6%
Curculionidae 4.6%
Tenebrionidae 4.2%
Elmidae 3.8%
Formicidae 3.5%
Calliphoridae 3.1%
Culicidae 2.3%
Termitidae 2.3%
Apidae 1.9%
Armadillidiidae 1.9%
Cerambycidae 1.5%
Palinuridae 1.2%
Talitridae 1.2%
Pteromalidae 1.2%
Tephritidae 1.2%
Aphididae 0.8%
Pentatomidae 0.8%
Majidae 0.8%
Scarabaeidae 0.4%
Ceratophyllidae 0.4%
Trigoniulidae 0.4%
Nephropidae 0.4%
Daphniidae 0.4%
Thripidae 0.4%
Anthomyiidae 0.4%
Artemiidae 0.4%
Rhopalidae 0.4%
Penaeidae 0.4%
Rhinotermitidae 0.4%
Carabidae 0.4%
Siricidae 0.4%
Passalidae 0.4%
Crambidae 0.4%
Gryllidae 0.4%
Sarcophagidae 0.4%

🌳 Taxonomy

Archaea 0
Bacteria 291
Eukaryota 0
Viruses 0
Unclassified 12

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2967915117 Cronobacter sakazakii MOD1-Lc10g Isolate Calliphoridae
2 2997380424 Vibrio parahaemolyticus MVP1 Isolate Unclassified
3 3004010258 Citrobacter sp. JGM124 Isolate Drosophilidae
4 3300000333 Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony Metagenome Apidae
5 3300007142 Ant gut microbial communities from Cephalotes grandinosus, Brazil Metagenome Formicidae
6 3300024582 Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 Metagenome
7 2511231129 Vibrio sp. EJY3 Isolate Unclassified
8 2524614872 Arsenophonus nasoniae DSM 15247 Isolate Unclassified
9 2529292851 Providencia burhodogranariea DSM 19968 Isolate Drosophilidae
10 2565956518 Vibrio pacinii DSM 19139 Isolate Unclassified
11 2600255074 Vibrio proteolyticus NBRC 13287 Isolate Unclassified
12 2645727860 Winslowiella iniecta B120 Isolate Aphididae
13 2651870110 Izhakiella capsodis N6PO6 Isolate Unclassified
14 2687453754 Pseudomonadales bacterium Cag26 Isolate Unclassified
15 2693429575 Vibrio parahaemolyticus ISF-54-12 Isolate Unclassified
16 2703719240 Serratia marcescens ano2 Isolate Unclassified
17 2871771314 Pantoea sp. Ae16 Isolate Culicidae
18 2885046828 Erwinia sp. OLCASP19 Isolate Anthocoridae
19 2885054481 Erwinia sp. OLMDSP33 Isolate Anthocoridae
20 2902451016 Photobacterium leiognathi mandapamensis ajapo.4.1 Isolate Unclassified
21 2902896024 Pseudoalteromonas sp. S1612 Isolate Unclassified
22 2908136803 Vibrio owensii 1700302 Isolate Unclassified
23 2921842437 Cronobacter sakazakii MOD1-Lc10s Isolate Calliphoridae
24 2957730672 Cronobacter sakazakii MOD1-Md70g Isolate Muscidae
25 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
26 640963010 Vibrio harveyi HY01 Isolate Unclassified
27 648276708 Pantoea sp. aB Isolate Unclassified
28 8001394582 Limnobaculum allomyrinae BWR-B9 Isolate Scarabaeidae
29 8006199443 Yersinia pestis M-1763 Isolate Ceratophyllidae
30 8011357093 Pseudomonas schmalbachii Milli4 Isolate Trigoniulidae
31 8022345672 Vibrio sp. 070316B Isolate Unclassified
32 8033364368 Vibrio panuliri LBS 2 Isolate Nephropidae
33 8073124432 Escherichia coli MOD1-EC294 Isolate Unclassified
34 8074292191 Tatumella sp. JGM94 Isolate Drosophilidae
35 8101676404 Providencia sp. JGM172 Isolate Drosophilidae
36 2970791725 Serratia sp. OLBL1 Isolate Anthocoridae
37 2977691992 Cronobacter malonaticus MOD1-Md27g Isolate Muscidae
38 2977745872 Cronobacter sakazakii MOD1-Md1g Isolate Muscidae
39 2996467878 Serratia sp. OLFL2 Isolate Anthocoridae
40 3300002934 Ant worker gut metagenome for colony PL005 Metagenome Formicidae
41 3300007052 Ant gut microbial communities from Cephalotes eduarduli, Brazil Metagenome Formicidae
42 3300007190 Ant gut microbial communities from Cephalotes umbraculatus, Peru Metagenome Formicidae
43 3300007192 Ant gut microbial communities from Cephalotes persimplex, Brazil Metagenome Formicidae
44 3300012839 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG Metagenome Culicidae
45 2065487013 Fungus-growing termite worker microbial communities from South Africa - Oerleman's Farm Metagenome
46 2531839602 Shimwellia blattae NBRC 105725 Isolate Unclassified
47 2574179716 Serratia sp. DD3 Isolate Daphniidae
48 2597489903 Providencia sneebia DSM 19967 Isolate Drosophilidae
49 2609459958 Vibrio nigripulchritudo Wn13 Isolate Unclassified
50 2630968716 Vibrio nigripulchritudo AM115 Isolate Unclassified
51 2636415542 Vibrio nigripulchritudo SFn135 Isolate Unclassified
52 2654587515 Vibrio owensii CAIM 1854 Isolate Palinuridae
53 2718217944 Serratia marcescens AS1 Isolate Culicidae
54 2765235945 Kosakonia cowanii Esp_Z Isolate Culicidae
55 2844251356 Photobacterium leiognathi mandapamensis ajapo.3.1 Isolate Unclassified
56 2858407585 Photobacterium swingsii DSM 24669 Isolate Unclassified
57 2864764899 Aeromonas fluvialis S00019 Isolate Elmidae
58 2864768727 Aeromonas veronii S00020 Isolate Elmidae
59 2874434233 Serratia marcescens ADJS-2C_Red Isolate Unclassified
60 2880115952 Vibrio parahaemolyticus PB1937 Isolate Unclassified
61 2900349738 Photobacterium lucens CAIM 1938 Isolate Unclassified
62 2912636047 Vibrio crassostreae 9CS106 Isolate Unclassified
63 2961232173 Serratia sp. OLLOLW30 Isolate Anthocoridae
64 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
65 3300056814 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE (version 2) Metagenome Tenebrionidae
66 3300057007 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP_oats (version 2) Metagenome Tenebrionidae
67 8048928574 Photobacterium swingsii CECT 7576 Isolate Unclassified
68 8100176769 Kosakonia sp. S57 Isolate Curculionidae
69 2965197371 Serratia sp. OLCL1 Isolate Anthocoridae
70 3001459110 Tatumella sp. JGM118 Isolate Drosophilidae
71 3300012846 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG Metagenome Armadillidiidae
72 2507262057 Enterobacteriaceae bacterium FGI 57 Isolate Unclassified
73 2551306516 Enterobacter hormaechei YT3 Isolate Tenebrionidae
74 2571042430 Vibrio harveyi NBRC 15634 Isolate Talitridae
75 2603880173 Pseudomonas SP. Isolate Unclassified
76 2627854002 Vibrio nigripulchritudo ENn2 Isolate Unclassified
77 2687453755 Pseudomonadales bacterium Cag27 Isolate Unclassified
78 2711768158 Vibrio coralliilyticus S2043 Isolate Unclassified
79 2850895757 Vibrio campbellii 170502 Isolate Unclassified
80 2860776474 Vibrio parahaemolyticus R14 Isolate Unclassified
81 2864903489 Pseudomonas aeuginosa S00161 Isolate Elmidae
82 2870361953 Entomomonas moraniae QZS01 Isolate Apidae
83 2871760914 Pantoea ananatis PANS 01-2 Isolate Thripidae
84 2872471378 Vibrio owensii V180403 Isolate Unclassified
85 2891720358 Azoarcus nasutitermitis CC-YHH838 Isolate Unclassified
86 2902916284 Pseudoalteromonas rubra S1946 Isolate Unclassified
87 2921816052 Cronobacter sakazakii MOD1-Anth48g Isolate Anthomyiidae
88 2922113941 Serratia sp. OLEL1 Isolate Anthocoridae
89 2937427229 Cronobacter malonaticus MOD1-Md99g Isolate Muscidae
90 2937751072 Serratia sp. OLMTLW26 Isolate Anthocoridae
91 2958255616 Serratia marcescens TM Isolate
92 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
93 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
94 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
95 651324086 Plautia crossota stali symbiont Isolate Unclassified
96 8001059720 Tenebrionicola larvae YMB-R22 Isolate Tenebrionidae
97 8022087107 Vibrio sp. OULL4 Isolate Unclassified
98 8022439116 Vibrio sp. ArtGut-C1 Isolate Artemiidae
99 8062647588 Nissabacter archeti JGM97 Isolate Drosophilidae
100 8071333649 Escherichia coli PN108 Isolate Calliphoridae
101 8071338694 Escherichia coli PN87 Isolate Calliphoridae
102 8102982778 Erwinia sp. S63 Isolate Curculionidae
103 2967924226 Cronobacter malonaticus MOD1-Md25g Isolate Muscidae
104 2970322301 Cronobacter sakazakii MOD1-Md33g Isolate Muscidae
105 2989793055 Vibrio atypicus DSM 25292 Isolate Unclassified
106 2996406003 Serratia sp. OLJL1 Isolate Anthocoridae
107 3001462594 Tatumella sp. JGM91 Isolate Drosophilidae
108 3300007188 Ant gut microbial communities from Cephalotes rohweri, Arizona, USA Metagenome Formicidae
109 3300012837 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E6 MG Metagenome Armadillidiidae
110 2588253732 Klebsiella pneumoniae pneumoniae KP5-1 Isolate Pentatomidae
111 2609459925 Vibrio nigripulchritudo SO65 Isolate Unclassified
112 2627853677 Vibrio nigripulchritudo FTn2 Isolate Unclassified
113 2684622551 Vibrio campbellii E1 Isolate Unclassified
114 2731957638 Vibrio harveyi NBRC 15634 Isolate Talitridae
115 2824588292 Yokenella regensburgei WCD67 Isolate Rhopalidae
116 2847708326 Serratia liquefaciens P2ACOL2 Isolate Cerambycidae
117 2856068565 Cronobacter sakazakii MOD1-Md35s Isolate Muscidae
118 2864791955 Aeromonas veronii S00030 Isolate Elmidae
119 2864847319 Pseudomonas alcaligenes S00099 Isolate Elmidae
120 2874504452 Serratia marcescens ADJS-2C_Purple Isolate Unclassified
121 2875320051 Vibrio parahaemolyticus 160807 Isolate Unclassified
122 2877638525 Vibrio campbellii 1114GL Isolate Penaeidae
123 2877647439 Vibrio parahaemolyticus R13 Isolate Unclassified
124 2885058212 Erwinia sp. OLTSP20 Isolate Anthocoridae
125 2896925746 Vibrio nigripulchritudo SFn27 Isolate Unclassified
126 2902469402 Photobacterium lucens CAIM 1937 Isolate Unclassified
127 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
128 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
129 8004118532 Citrobacter amalonaticus ku-bf3 Isolate Carabidae
130 8022096067 Vibrio sp. SALL6 Isolate Unclassified
131 8022116796 Vibrio sp. T3Y01 Isolate Unclassified
132 8051461712 Vibrio vulnificus Vv002 Isolate
133 8052469819 Pseudomonas putida DZ-F23 Isolate
134 8060845732 Vibrio vulnificus Vv006 Isolate
135 8071343737 Escherichia coli PN119 Isolate Calliphoridae
136 8074288691 Tatumella sp. JGM82 Isolate Drosophilidae
137 8101683685 Providencia sp. JGM181 Isolate Drosophilidae
138 2977727922 Cronobacter sakazakii MOD1-Md33s Isolate Muscidae
139 2978102237 Serratia fonticola AeS1 Isolate Culicidae
140 2987233858 Stutzerimonas stutzeri AR9-4 Isolate Unclassified
141 3007994558 Escherichia alba B35 Isolate Tenebrionidae
142 3300007224 Drosophila gut microbial communities from New York, USA - Drosophila melanogaster male 3 gut Metagenome Unclassified
143 3300012809 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E11 MG Metagenome
144 2100351016 Sirex noctilio microbial communities from Pennsylvania, USA - adult community Metagenome Siricidae
145 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
146 2524614573 Marinospirillum minutulum DSM 6287 Isolate Unclassified
147 2551306531 Enterobacter hormaechei YT2 Isolate Tenebrionidae
148 2648501820 Vibrio nigripulchritudo BLFn1 Isolate Unclassified
149 2667527830 Vibrio parahaemolyticus ISF-29-3 Isolate Unclassified
150 2681813507 Insolitispirillum peregrinum integrum DSM 11589 Isolate Unclassified
151 2700989396 Vibrio parahaemolyticus ISF-77-01 Isolate Unclassified
152 2756170277 Enterobacillus tribolii DSM 103736 Isolate Unclassified
153 2785510762 Vibrio parahaemolyticus VP14 Isolate Unclassified
154 2833053935 Buttiauxella sp. 3AFRM03 Isolate Cerambycidae
155 2833478085 Oceanospirillum multiglobuliferum ATCC 33336 Isolate Unclassified
156 2837516909 Rahnella bruchi DSM 27398 Isolate Unclassified
157 2841260384 Providencia alcalifaciens Dmel2 Isolate Drosophilidae
158 2864944480 Pseudomonas fluvialis S00202 Isolate Elmidae
159 2878947168 Serratia marcescens ADJS-2D_White Isolate Unclassified
160 2885043073 Erwinia sp. OLSSP12 Isolate Anthocoridae
161 2896187957 Providencia stuartii Crippen Isolate Calliphoridae
162 2902438364 Photobacterium damselae Hep-2a-11 Isolate Unclassified
163 2937735258 Serratia marcescens KZ11 Isolate Apidae
164 2961247850 Serratia sp. OLAL2 Isolate Anthocoridae
165 8004307473 Serratia sp. OLIL2 Isolate Anthocoridae
166 8004571736 Serratia sp. OLDL1 Isolate Anthocoridae
167 8008122225 Vibrio harveyi CAIM 1792 Isolate Unclassified
168 8021535516 Klebsiella sp. Kd70 TUC-EEAOC Isolate Crambidae
169 8042061949 Vibrio harveyi Hep-2a-10 Isolate Unclassified
170 8100181737 Kosakonia sp. S58 Isolate Curculionidae
171 8116627632 Vibrio penaeicida NBRC 15640 Isolate Unclassified
172 2978161719 Serratia marcescens KZ2 Isolate Apidae
173 3004364956 Cronobacter sakazakii MOD1-Md5s Isolate Muscidae
174 3006225627 Vibrio sp. Hep-1b-8 Isolate Unclassified
175 3006242587 Vibrio sp. RE86 Isolate Unclassified
176 3300003973 Ips typographus gut microbial communities from Hannover, Germany - first DNA extraction october 2014, adult beetle Metagenome Curculionidae
177 3300007095 Ant gut microbial communities from Cephalotes minutus, Brazil Metagenome Formicidae
178 3300007106 Drosophila gut microbial communities from New York, USA - Drosophila falleni male 3 gut Metagenome Drosophilidae
179 3300012841 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E1 MG Metagenome Armadillidiidae
180 3300012847 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG Metagenome Armadillidiidae
181 2035918003 Mountain Pine Beetle microbial communities from McBride, British Columbia, Canada - Lodgepole pine Metagenome Curculionidae
182 2518285522 Photorhabdus khanii NC19 Isolate Unclassified
183 2547132185 Enterobacter cancerogenus YZ1 Isolate Tenebrionidae
184 2551306507 Vibrio parahaemolyticus PCV08-7 Isolate Unclassified
185 2582581321 Oceanospirillum multiglobuliferum ATCC 33336 Isolate Unclassified
186 2619619082 Pantoea agglomerans SL1_M5 Isolate Unclassified
187 2636415586 Vibrio harveyi NBRC 15634 Isolate Talitridae
188 2667527887 Vibrio harveyi LMG 4044 Isolate Unclassified
189 2778261152 Escherichia coli MOD1-EC284 Isolate Unclassified
190 2791355471 Vibrio bivalvicida 605 Isolate Unclassified
191 2791355473 Vibrio barjaei 3062 Isolate Unclassified
192 2822856742 Enterobacter cancerogenus CR-Eb1 Isolate Unclassified
193 2850131454 Providencia rettgeri NVIT03 Isolate Pteromalidae
194 2864777284 Aeromonas hydrophila S00023 Isolate Elmidae
195 2864796242 Aeromonas hydrophilia S00040 Isolate Elmidae
196 2873884416 Photobacterium sanguinicancri Mj110 CAIM 1827 Isolate Majidae
197 2874880541 Enterobacter hormaechei E3442 Isolate Unclassified
198 2964846109 Cronobacter sakazakii MOD1-Md5g Isolate Muscidae
199 2964859436 Cronobacter sakazakii MOD1-Md40g Isolate Muscidae
200 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
201 3300056790 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) Metagenome Tenebrionidae
202 3300056856 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) Metagenome Tenebrionidae
203 8018312681 Enterobacter sp. OLF Isolate Tephritidae
204 8021540981 Klebsiella sp. Kpp Isolate Tephritidae
205 8028002147 Enterobacter sp. 10-1 Isolate Cerambycidae
206 8048923410 Photobacterium sanguinicancri CECT 7579 Isolate Unclassified
207 8051534459 Vibrio vulnificus Vv004 Isolate
208 8099192374 Erwinia typographi IC4 Isolate Curculionidae
209 8110023836 Enterobacterales bacterium BIT-L3 Isolate Tenebrionidae
210 2990166910 Pseudomonas typographi CA3A Isolate Curculionidae
211 3000478755 Entomomonas asaccharolytica F2A Isolate Gryllidae
212 3007478678 Pseudomonas sp. S37 Isolate Curculionidae
213 3300007505 Drosophila gut microbial communities from New York, USA - Drosophila suzukii female 6 gut Metagenome Drosophilidae
214 3300007507 Drosophila gut microbial communities from New York, USA - Drosophila suzukii male 4 gut Metagenome Drosophilidae
215 3300012798 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E6 MG Metagenome
216 3300012803 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E11 MG Metagenome
217 3300012814 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E6 MG Metagenome
218 2513020017 Shimwellia blattae DSM 4481 Isolate Unclassified
219 2571042554 Vibrio owensii CAIM 1854 Isolate Palinuridae
220 2597489902 Providencia rettgeri Dmel1 Isolate Drosophilidae
221 2671180705 Pseudoalteromonas piscicida S2040 Isolate Unclassified
222 2687453756 Pseudomonadales bacterium Cag32 Isolate Unclassified
223 2836714267 Shimwellia blattae NCTC10965 Isolate
224 2836755666 Arsenophonus nasoniae FIN Isolate Pteromalidae
225 2846386538 Rahnella sp. AN3-3W3 Isolate Pentatomidae
226 2864751016 Pseudomonas oryzihabitans S00005 Isolate Elmidae
227 2868883784 Photobacterium leiognathi mandapamensis AJ-1a Isolate Unclassified
228 2876358570 Cronobacter sakazakii MOD1-Ls15g Isolate Calliphoridae
229 2937387794 Cronobacter turicensis MOD1-Sh41g Isolate Sarcophagidae
230 2938192669 Citrobacter sp. TSA-1 Isolate Unclassified
231 637000219 Pseudomonas entomophila L48 Isolate Unclassified
232 8021546568 Klebsiella sp. Kps Isolate Tephritidae
233 8033368880 Vibrio panuliri CAIM 1902 Isolate Palinuridae
234 8065462725 Tatumella sp. JGM100 Isolate Drosophilidae
235 8065466226 Tatumella sp. JGM130 Isolate Drosophilidae
236 8065469765 Tatumella sp. JGM16 Isolate Drosophilidae
237 8071322446 Escherichia coli PN122 Isolate Calliphoridae
238 8100171289 Kosakonia sp. S42 Isolate Curculionidae
239 8101680043 Providencia sp. JGM178 Isolate Drosophilidae
240 8103002986 Erwinia sp. S38 Isolate Curculionidae
241 8103008710 Erwinia sp. S43 Isolate Curculionidae
242 3300002932 Cephalotes varians larva microbial communities from Drexel University, Philadelphia, USA - Larval gut metagenome for colony PL010 Metagenome Formicidae
243 3300005318 Drosophila gut microbial communities from New York, USA - Drosophila falleni female 2 gut Metagenome Drosophilidae
244 3300007067 Ant gut microbial communities from Cephalotes spinosus, Peru Metagenome Formicidae
245 3300012848 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG Metagenome Armadillidiidae
246 2510065002 Arsenophonus sp. ArN Isolate Pteromalidae
247 2519899623 Enterobacter sp. Ag1 Isolate Culicidae
248 2528768159 Alteromonadaceae bacterium Bs31 Isolate Unclassified
249 2531839005 Vibrio harveyi CAIM 1792 Isolate Unclassified
250 2537561600 Salmonella enterica enterica sv. Newport CVM 19443 Isolate Unclassified
251 2551306520 Aliivibrio logei ATCC 35077 Isolate Majidae
252 2554235022 Vibrio parahaemolyticus v110 Isolate
253 2588253791 Yokenella regensburgei F. Haas DC-1, ATCC 49455 Isolate Unclassified
254 2648501158 Vibrio hepatarius DSM 19134 Isolate Unclassified
255 2648501209 Winslowiella iniecta B149 Isolate Aphididae
256 2663763317 Vibrio parahaemolyticus ISF-94-1 Isolate Unclassified
257 2703719239 Serratia marcescens ano1 Isolate Unclassified
258 2778261153 Escherichia coli MOD1-EC286 Isolate Unclassified
259 2835335304 Rahnella sp. Larv3_ips Isolate Curculionidae
260 2859315706 Serratia sp. 3ACOL1 Isolate Cerambycidae
261 2864926767 Pseudomonas nitritireducens S00179 Isolate Elmidae
262 2876334352 Cronobacter sakazakii MOD1-Md6g Isolate Muscidae
263 2885050628 Erwinia sp. OLMTSP26 Isolate Anthocoridae
264 2885061987 Erwinia sp. OLFS4 Isolate Anthocoridae
265 2885065815 Erwinia sp. OAMSP11 Isolate Anthocoridae
266 2889908211 Bowmanella denitrificans JL63 Isolate Unclassified
267 2898991528 Erwinia sp. OLMDLW33 Isolate Anthocoridae
268 2912570088 Vibrio parahaemolyticus CHN25 Isolate
269 2961206375 Serratia sp. OMLW3 Isolate Anthocoridae
270 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
271 3300056842 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) Metagenome Tenebrionidae
272 8004285568 Serratia sp. OLHL2 Isolate Anthocoridae
273 8004541719 Serratia marcescens KZ19 Isolate Apidae
274 8004582426 Serratia sp. OSPLW9 Isolate Anthocoridae
275 8035422605 Pseudomonas monteilii CY06 Isolate
276 8051551332 Vibrio vulnificus Vv003 Isolate

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0562379_0001 3300056790 Bacteria 4904077
2 Ga0562375_5828 3300056856 Unclassified 6588
3 SWWA_contig06911__length_4094___numreads_63 2100351016 Unclassified 4094
4 Ga0102737_1001292 3300007142 Bacteria 7131
5 Ga0103267_1000118 3300007190 Bacteria 31936
6 Ga0466701_022173 3300042598 Bacteria 77061
7 Ga0562375_2057 3300056856 Unclassified 23898
8 Ga0265387_1000111 3300024582 Bacteria 18015
9 Ga0160465_100488 3300012803 Bacteria 19065
10 Ga0160466_100236 3300012809 Bacteria 38723
11 DPOL_contig12646 2035918003 Bacteria 137161
12 Ga0102736_1001570 3300007052 Bacteria 3951
13 Ga0105005_1032721 3300007505 Bacteria 6584
14 Ga0466713_140012 3300042602 Bacteria 490520
15 Ga0466730_025937 3300042625 Bacteria 4853
16 Ga0466724_56116 3300042649 Bacteria 64041
17 Ga0562378_0018 3300056814 Bacteria 860182
18 Ga0562377_0001 3300056842 Bacteria 5082480
19 Ga0160455_100106 3300012837 Bacteria 123068
20 Ga0160472_100019 3300012839 Bacteria 338828
21 Ga0160444_100919 3300012841 Unclassified 7687
22 Ga0160454_100228 3300012798 Unclassified 56494
23 FGTW_contig30407 2065487013 Bacteria 95704
24 SWWA_contig31705__length_14536___numreads_728 2100351016 Bacteria 14536
25 2227080778 2225789004 Bacteria 173705
26 HBC_ctgsDRAFT_1004572 3300000333 Bacteria 3215
27 Ga0063521_1001002 3300003973 Unclassified 9057
28 Ga0104041_1002914 3300007106 Bacteria 9509
29 Ga0562377_0035 3300056842 Bacteria 679350
30 Ga0160443_102119 3300012848 Bacteria 4891
31 Ga0103264_1000099 3300007188 Bacteria 118917
32 Ga0466701_097606 3300042598 Bacteria 26639
33 Ga0466730_039382 3300042625 Unclassified 43249
34 Ga0466724_38338 3300042649 Bacteria 3178
35 Ga0160433_100403 3300012846 Bacteria 23537
36 DPOL_contig03866 2035918003 Unclassified 16500
37 CVPL010L_1000111 3300002932 Bacteria 91591
38 Ga0063521_1000204 3300003973 Bacteria 42441
39 Ga0074188_1039638 3300005318 Bacteria 3342
40 Ga0103268_1000364 3300007192 Bacteria 14489
41 Ga0466724_67921 3300042649 Bacteria 67072
42 Ga0466733_175091 3300042659 Bacteria 58462
43 CVPL005W_1000891 3300002934 Unclassified 9635
44 Ga0466722_035155 3300042609 Bacteria 7117
45 Ga0466724_06979 3300042649 Bacteria 72487
46 Ga0466724_08705 3300042649 Unclassified 13447
47 Ga0466724_23023 3300042649 Bacteria 116535
48 Ga0466724_29917 3300042649 Unclassified 3016
49 Ga0562375_0004 3300056856 Bacteria 3010592
50 Ga0562374_0253 3300057007 Bacteria 106738
51 Ga0160445_100560 3300012847 Unclassified 17234
52 CVPL010L_1000410 3300002932 Bacteria 13809
53 Ga0063521_1000002 3300003973 Bacteria 391466
54 Ga0063521_1000026 3300003973 Bacteria 128736
55 Ga0104147_1005879 3300007224 Bacteria 12324
56 Ga0105008_1016739 3300007507 Bacteria 4189
57 Ga0466713_098270 3300042602 Bacteria 331235
58 Ga0466730_028713 3300042625 Bacteria 31522
59 Ga0466710_325543 3300042613 Bacteria 69248
60 Ga0562377_0037 3300056842 Bacteria 656123
61 Ga0160453_100700 3300012814 Bacteria 20137
62 FGTW_contig31883 2065487013 Bacteria 3220
63 HBC_ctgsDRAFT_1000224 3300000333 Bacteria 13196
64 Ga0063521_1000166 3300003973 Bacteria 49372
65 Ga0103266_1000009 3300007067 Bacteria 102792
66 Ga0102739_1000300 3300007095 Bacteria 11327
67 Ga0466707_165434 3300042601 Bacteria 3051
68 Ga0466734_129637 3300042623 Bacteria 4462
69 Ga0466730_092823 3300042625 Bacteria 6644
70 Ga0466724_20429 3300042649 Bacteria 10275
71 Ga0466724_41873 3300042649 Bacteria 54938

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF05430 Methyltransf_30 S-adenosyl-L-methionine-dependent methyltransferase 140 265 0.98
PF01266 DAO FAD dependent oxidoreductase 289 669 0.85

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF05430 GO:0016645 oxidoreductase activity, acting on the CH-NH group of donors MF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.