Protein Family IF13599

Metagenome Isolate
225 Members
77 Samples
191 Scaffolds
332.44 Avg Length

🧬 Representative Sequence

ID
iso_pr_bacteria|651324002|651578112|
Length
363 aa
Sequence
MTRYGCFMIYKWSKKDFEGGHIVKRYWKEILVFSLILGVMLAGCGGQQAQDTKGKPTIGVAIYKFDDTFMTGVRNAISQAGEGKAQVDIVDSQNSQPTQNDKVDLFITKKTNALAINPVDRTAAGVIIDKAKKANIPVVFLNREPLPEDMKKWDKVYYVGAKAEESGTISGQLIVDHWKAHPEMDKNKDGVLQYVMLKGEPGHQDAELRTKYSVQAVQDAGIKVEKVAEDTGMWDRVKGQEKMAAFLAAHGDKIEAVFANNDDMALGAIEALKANGYFKDGKFLPVVGVDATAPALKALEEGTMLGTVLNDAKNQGKATFNLTYVLAQGQTPNKENSGYEIVDGKYIWIPYKKITKANMNDAK

📊 Sample Types

Isolate 15.1%
Metagenome 84.9%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 23.0%
Blattidae 21.6%
Kalotermitidae 21.6%
Unclassified 14.9%
Rhinotermitidae 4.1%
Termopsidae 4.1%
Curculionidae 2.7%
Apidae 2.7%
Hodotermitidae 1.4%
Culicidae 1.4%
Tenebrionidae 1.4%
Scarabaeidae 1.4%

🌳 Taxonomy

Archaea 0
Bacteria 213
Eukaryota 0
Viruses 0
Unclassified 12

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2781125697 Treponema sp. Th196P4bin17 Isolate Unclassified
2 2820332331 Unclassified Firmicutes Nt197P3bin75 Isolate Unclassified
3 2848339753 Ephemeroptericola cinctiostellae F02 Isolate Unclassified
4 2940221333 Paenibacillus sp. PastF-3 Isolate Blattidae
5 2940425923 Paenibacillus sp. PastH-4 Isolate Blattidae
6 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
7 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
8 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
9 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
10 2940349480 Fusobacterium sp. PH5-44 Isolate Blattidae
11 2940406939 Paenibacillus sp. PastM-3 Isolate Blattidae
12 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
13 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
14 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
15 651324002 Acetonema longum APO-1, DSM 6540 Isolate Kalotermitidae
16 651324086 Plautia crossota stali symbiont Isolate Unclassified
17 8102982778 Erwinia sp. S63 Isolate Curculionidae
18 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
19 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
20 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
21 2827179085 Paenibacillus alvei DSM 29 Isolate Apidae
22 2940241992 Fusobacterium sp. PH5-29 Isolate Blattidae
23 2940264388 Lachnospiraceae bacterium PFB1-17 Isolate Blattidae
24 2940267548 Lachnospiraceae bacterium PFB1-22 Isolate Blattidae
25 2940419646 Paenibacillus sp. PastF-4 Isolate Blattidae
26 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
27 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
28 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
29 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
30 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
31 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
32 3300042550 Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 Metagenome Termitidae
33 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
34 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
35 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
36 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
37 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
38 2590828840 Clostridium sp. 2 Isolate Termitidae
39 2820389254 Unclassified Firmicutes Nc150P4bin19 Isolate Unclassified
40 2871771314 Pantoea sp. Ae16 Isolate Culicidae
41 2940400224 Paenibacillus sp. PastM-2 Isolate Blattidae
42 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
43 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
44 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
45 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
46 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
47 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
48 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
49 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
50 2636416028 Pelosinus propionicus DSM 13327 Isolate Unclassified
51 2940393498 Paenibacillus sp. PastF-2 Isolate Blattidae
52 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
53 3300056842 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) Metagenome Tenebrionidae
54 2940373808 Fusobacterium sp. PH5-7 Isolate Blattidae
55 2940386776 Paenibacillus sp. PastF-1 Isolate Blattidae
56 2971438493 Paenibacillus apiarius NRRL B-23460 Isolate Apidae
57 646311952 Sebaldella termitidis ATCC 33386 Isolate Unclassified
58 8099192374 Erwinia typographi IC4 Isolate Curculionidae
59 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
60 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
61 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
62 2940273867 Lachnoclostridium sp. PH1-16 Isolate Blattidae
63 3300012814 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E6 MG Metagenome
64 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
65 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
66 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
67 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
68 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
69 2503904012 Sphaerochaeta coccoides SPN1, DSM 17374 Isolate Kalotermitidae
70 2820573558 Unclassified Firmicutes Emb289P3bin140 Isolate Unclassified
71 2852337885 Paenibacillus protaetiae FW100M-2 Isolate Scarabaeidae
72 2940270707 Lachnoclostridium sp. PF1-13 Isolate Blattidae
73 2940380068 Paenibacillus sp. PastH-2 Isolate Blattidae
74 2940413413 Paenibacillus sp. PastH-3 Isolate Blattidae
75 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
76 3300012809 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E11 MG Metagenome
77 650716102 Treponema primitia ZAS-2 Isolate Unclassified

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466732_139434 3300042656 Bacteria 4458
2 Ga0466712_113887 3300042614 Bacteria 2307
3 Ga0466711_078262 3300042615 Bacteria 23168
4 Ga0466711_285962 3300042615 Bacteria 5820
5 Ga0466715_482469 3300042616 Bacteria 16082
6 Ga0466728_118265 3300042620 Bacteria 2950
7 Ga0466728_198548 3300042620 Bacteria 3614
8 Ga0466691_021239 3300042593 Bacteria 18782
9 Ga0466691_064698 3300042593 Bacteria 6450
10 Ga0466706_065934 3300042599 Unclassified 2331
11 Ga0466713_101071 3300042602 Bacteria 7829
12 Ga0466713_134397 3300042602 Bacteria 97168
13 Ga0466716_324168 3300042605 Bacteria 1979
14 Ga0466719_128529 3300042606 Bacteria 11404
15 Ga0466719_278187 3300042606 Bacteria 19651
16 Ga0466703_395122 3300042636 Bacteria 51270
17 Ga0466704_419669 3300042643 Bacteria 40007
18 Ga0466708_071888 3300042652 Bacteria 10996
19 Ga0466708_229882 3300042652 Bacteria 5534
20 Ga0466708_439873 3300042652 Bacteria 2890
21 Ga0466727_019384 3300042655 Bacteria 6422
22 Ga0466727_287817 3300042655 Bacteria 5481
23 Ga0068305_10106990 3300005083 Unclassified 16446
24 Ga0123357_10003187 3300009784 Bacteria 18674
25 Ga0466732_079695 3300042656 Bacteria 3211
26 Ga0466732_158615 3300042656 Bacteria 3797
27 Ga0466733_044706 3300042659 Bacteria 4662
28 Ga0466733_086322 3300042659 Bacteria 14838
29 Ga0466711_017121 3300042615 Bacteria 2940
30 Ga0466711_055301 3300042615 Unclassified 1414
31 Ga0466711_201941 3300042615 Bacteria 4259
32 Ga0466711_220594 3300042615 Bacteria 2970
33 Ga0466715_049472 3300042616 Unclassified 1716
34 Ga0466723_029299 3300042618 Bacteria 122062
35 Ga0466726_216293 3300042619 Bacteria 1954
36 Ga0466696_448804 3300042596 Unclassified 1094
37 Ga0123353_10029356 3300010167 Bacteria 8473
38 Ga0123353_10076890 3300010167 Bacteria 5363
39 Ga0466713_001853 3300042602 Bacteria 35525
40 Ga0466719_190347 3300042606 Bacteria 2670
41 Ga0466722_020194 3300042609 Bacteria 7556
42 Ga0466735_108884 3300042624 Bacteria 1008
43 Ga0466709_384294 3300042648 Bacteria 4564
44 Ga0466708_023644 3300042652 Bacteria 18494
45 JGI24702J35022_10011447 3300002462 Bacteria 4943
46 Ga0466733_061426 3300042659 Bacteria 2108
47 Ga0466733_132363 3300042659 Bacteria 1315
48 Ga0466705_470336 3300042612 Bacteria 6486
49 Ga0466715_209947 3300042616 Bacteria 2672
50 Ga0466715_547491 3300042616 Bacteria 4749
51 Ga0466715_643384 3300042616 Unclassified 7475
52 Ga0466723_065415 3300042618 Bacteria 6235
53 Ga0466723_272430 3300042618 Bacteria 1528
54 Ga0466728_372205 3300042620 Bacteria 6775
55 Ga0466690_007907 3300042590 Unclassified 1321
56 Ga0466691_016003 3300042593 Bacteria 10028
57 Ga0466696_048080 3300042596 Bacteria 5733
58 Ga0123357_10107027 3300009784 Bacteria 3582
59 Ga0123353_10489548 3300010167 Bacteria 1796
60 Ga0123353_10510188 3300010167 Bacteria 1748
61 Ga0123354_10262474 3300010882 Bacteria 1721
62 Ga0160466_100941 3300012809 Bacteria 10247
63 Ga0466716_052743 3300042605 Bacteria 4870
64 Ga0466716_181571 3300042605 Bacteria 26028
65 Ga0466719_299272 3300042606 Bacteria 25760
66 Ga0466720_170477 3300042607 Bacteria 4609
67 Ga0466735_015230 3300042624 Bacteria 13305
68 Ga0466735_137056 3300042624 Bacteria 11891
69 Ga0466735_156397 3300042624 Bacteria 1430
70 Ga0466703_035717 3300042636 Bacteria 1689
71 Ga0466704_075497 3300042643 Bacteria 3270
72 Ga0466704_184778 3300042643 Bacteria 18637
73 Ga0466704_352299 3300042643 Unclassified 2834
74 Ga0466704_369287 3300042643 Bacteria 41126
75 Ga0466704_449711 3300042643 Unclassified 8233
76 Ga0466709_220246 3300042648 Bacteria 5189
77 Ga0466708_093338 3300042652 Bacteria 7065
78 Ga0466705_067237 3300042612 Bacteria 10860
79 Ga0466705_518680 3300042612 Bacteria 4145
80 Ga0466723_073448 3300042618 Bacteria 9273
81 Ga0466726_149388 3300042619 Bacteria 24904
82 Ga0466728_170815 3300042620 Bacteria 10130
83 Ga0466728_376086 3300042620 Bacteria 1404
84 Ga0466691_161125 3300042593 Bacteria 4389
85 Ga0466691_181813 3300042593 Bacteria 9144
86 Ga0123356_10109376 3300010049 Bacteria 2667
87 Ga0123356_10616444 3300010049 Bacteria 1250
88 Ga0123353_10258684 3300010167 Bacteria 2691
89 Ga0466719_141298 3300042606 Bacteria 13025
90 Ga0466719_151569 3300042606 Bacteria 7890
91 Ga0466719_212494 3300042606 Bacteria 4024
92 Ga0466722_075010 3300042609 Bacteria 4771
93 Ga0466722_218194 3300042609 Bacteria 18029
94 Ga0466735_091067 3300042624 Bacteria 5945
95 Ga0466703_030949 3300042636 Bacteria 4057
96 Ga0466703_120531 3300042636 Bacteria 7503
97 Ga0466704_341300 3300042643 Bacteria 9653
98 Ga0466709_149274 3300042648 Bacteria 16720
99 Ga0466708_024625 3300042652 Bacteria 23012
100 Ga0466708_381931 3300042652 Bacteria 28964
101 Ga0466705_124118 3300042612 Bacteria 9927
102 Ga0466732_012002 3300042656 Bacteria 1355
103 Ga0562377_0035 3300056842 Bacteria 679350
104 Ga0466726_030189 3300042619 Bacteria 1430
105 Ga0466726_183223 3300042619 Bacteria 4234
106 Ga0160453_100130 3300012814 Bacteria 77370
107 Ga0466656_060210 3300042550 Bacteria 1480
108 Ga0466692_101146 3300042591 Bacteria 6891
109 Ga0466694_203980 3300042594 Bacteria 3757
110 Ga0466696_377531 3300042596 Bacteria 9588
111 Ga0466701_079262 3300042598 Bacteria 82965
112 Ga0466703_044004 3300042636 Bacteria 4754
113 Ga0466703_376359 3300042636 Bacteria 2606
114 Ga0466704_075760 3300042643 Bacteria 5025
115 Ga0466708_081910 3300042652 Bacteria 3700
116 Ga0466708_213635 3300042652 Bacteria 1387
117 Ga0466708_265630 3300042652 Bacteria 1706
118 Ga0466727_242874 3300042655 Bacteria 4726
119 AustNasuHG_c1015805 3300000089 Bacteria 2539
120 JGI24698J34947_10057352 3300002449 Unclassified 1932
121 JGI24702J35022_10003831 3300002462 Bacteria 9025
122 Ga0466715_411943 3300042616 Bacteria 2951
123 Ga0466715_451136 3300042616 Bacteria 4028
124 Ga0466715_463361 3300042616 Bacteria 8319
125 Ga0466715_617748 3300042616 Bacteria 11047
126 Ga0466726_359885 3300042619 Bacteria 4398
127 Ga0466729_136900 3300042621 Bacteria 1766
128 Ga0466692_002717 3300042591 Bacteria 2987
129 Ga0466694_106291 3300042594 Bacteria 2966
130 Ga0466696_151210 3300042596 Bacteria 12476
131 Ga0123357_10199132 3300009784 Bacteria 2285
132 Ga0123356_10020336 3300010049 Bacteria 6282
133 Ga0123354_10232643 3300010882 Bacteria 1921
134 Ga0466706_264825 3300042599 Bacteria 10244
135 Ga0466719_151734 3300042606 Bacteria 12065
136 Ga0466722_027374 3300042609 Bacteria 3952
137 Ga0466722_121007 3300042609 Bacteria 30480
138 Ga0466703_154338 3300042636 Bacteria 13611
139 Ga0466704_567965 3300042643 Bacteria 1504
140 Ga0466709_383934 3300042648 Bacteria 2152
141 Ga0466708_213316 3300042652 Bacteria 3770
142 Ga0466708_289496 3300042652 Bacteria 7977
143 Ga0466727_081531 3300042655 Bacteria 2771
144 JGI24702J35022_10005033 3300002462 Bacteria 7784
145 Ga0072941_1178206 3300005201 Bacteria 1336
146 Ga0466705_026767 3300042612 Bacteria 8764
147 Ga0466732_256120 3300042656 Bacteria 1159
148 Ga0466733_131027 3300042659 Bacteria 9455
149 Ga0466711_337938 3300042615 Bacteria 11148
150 Ga0466723_056737 3300042618 Bacteria 51175
151 Ga0466728_380587 3300042620 Bacteria 4527
152 Ga0466694_277457 3300042594 Bacteria 4478
153 Ga0466694_329700 3300042594 Bacteria 4340
154 Ga0123356_10349374 3300010049 Bacteria 1602
155 Ga0466722_054951 3300042609 Bacteria 5600
156 Ga0466703_164994 3300042636 Bacteria 5506
157 Ga0466708_125224 3300042652 Bacteria 4585
158 Ga0466727_208035 3300042655 Bacteria 1403
159 Ga0466727_269537 3300042655 Bacteria 1758
160 AustNasuHG_c1000577 3300000089 Bacteria 12919
161 AustNasuHG_c1023919 3300000089 Bacteria 1943
162 JGI24698J34947_10001218 3300002449 Bacteria 13463
163 JGI24698J34947_10015823 3300002449 Bacteria 4102
164 JGI24695J34938_10001959 3300002450 Bacteria 16504
165 JGI24695J34938_10002138 3300002450 Bacteria 15433
166 JGI24695J34938_10016646 3300002450 Bacteria 3732
167 Ga0466705_213616 3300042612 Bacteria 12745
168 Ga0562377_0538 3300056842 Bacteria 59511
169 Ga0466712_176881 3300042614 Bacteria 9743
170 Ga0466711_431828 3300042615 Bacteria 2142
171 Ga0466715_099120 3300042616 Bacteria 6541
172 Ga0466715_099671 3300042616 Bacteria 5980
173 Ga0466715_254665 3300042616 Bacteria 14218
174 Ga0466723_082671 3300042618 Bacteria 6075
175 Ga0466726_312425 3300042619 Unclassified 6027
176 Ga0466692_151897 3300042591 Bacteria 4200
177 Ga0466693_023447 3300042592 Bacteria 44432
178 Ga0466691_157097 3300042593 Bacteria 12802
179 Ga0466696_198725 3300042596 Bacteria 16131
180 Ga0123356_10005742 3300010049 Unclassified 12594
181 Ga0123356_10023253 3300010049 Bacteria 5835
182 Ga0466706_079874 3300042599 Bacteria 11150
183 Ga0466722_227008 3300042609 Bacteria 2318
184 Ga0466735_102372 3300042624 Bacteria 3110
185 Ga0466703_093877 3300042636 Bacteria 6647
186 Ga0466704_216248 3300042643 Bacteria 4757
187 Ga0466704_320684 3300042643 Bacteria 7906
188 Ga0466708_296636 3300042652 Bacteria 5307
189 Ga0466727_228920 3300042655 Bacteria 39719
190 Ga0466727_262565 3300042655 Bacteria 5653
191 JGI24695J34938_10000033 3300002450 Bacteria 103928

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF13407 Peripla_BP_4 Periplasmic binding protein domain 58 330 0.94
PF00532 Peripla_BP_1 Periplasmic binding proteins and sugar binding domain of LacI family 56 279 0.83
PF13377 Peripla_BP_3 Periplasmic binding protein-like domain 199 277 0.81

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.