Protein Family IF13574
Metagenome
Isolate
163
Members
46
Samples
156
Scaffolds
234.12
Avg Length
Representative Sequence
- ID
- iso_pr_bacteria|650716102|650884297|
- Length
- 272 aa
- Sequence
- MSIVLITALFAAILAFVLGVALGFFKDFFAVEEDPLKGQVRECLPGANCGACGFPGCDGYATAVASGSAATNCCSVGGKDVAEKLSALMGVSAGSITPLVAIIACQGTPDKAPAKGNYTGLQTCRGAKLSTGGTKLCVWGCLGYGDCTVVCQFGALSLGENGLPKVDHTKCTGCKVCVAECPQGVIRAVAKDSQGAVVTCSNRNPLKATVLKTCKAGCIKCELCVKNCPENCITLQNGIPVVDYAKCTSCGTCGEKCPTKVFKILQKDVIAV
Sample Types
Isolate
4.3%
Metagenome
95.7%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
34.1%
Kalotermitidae
31.8%
Unclassified
15.9%
Rhinotermitidae
6.8%
Termopsidae
6.8%
Hodotermitidae
2.3%
Blaberidae
2.3%
Taxonomy
Archaea
1
Bacteria
156
Eukaryota
0
Viruses
0
Unclassified
6
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 2 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 3 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 4 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 5 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 6 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 7 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 8 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 9 | 2819992462 | Unclassified Spirochaetes Nc150P4bin14 | Isolate | Unclassified |
| 10 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 11 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 12 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 13 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 14 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 15 | 3300005485 | Termite gut microbial communities from Costa Rica - P3 luminal contents | Metagenome | Termitidae |
| 16 | 650716099 | Leadbettera azotonutricia ZAS-9 | Isolate | Unclassified |
| 17 | 650716102 | Treponema primitia ZAS-2 | Isolate | Unclassified |
| 18 | 2772190975 | Treponema sp. RmG30 | Isolate | Blaberidae |
| 19 | 3300001880 | Termite hindgut microbial communities from the Max Planck Institute, Bremen, Germany, analyzing fibers in the hindgut lumen - ASSEMBLED Fiber-Associated Metagenome | Metagenome | |
| 20 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 21 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 22 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 23 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 24 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 25 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 26 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 27 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 28 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 29 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 30 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 31 | 2781125694 | Treponema sp. Th196P3bin120 | Isolate | Unclassified |
| 32 | 2781125697 | Treponema sp. Th196P4bin17 | Isolate | Unclassified |
| 33 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 34 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 35 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 36 | 2781125695 | Treponema sp. Th196P4bin30 | Isolate | Unclassified |
| 37 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 38 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 39 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 40 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 41 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 42 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 43 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 44 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 45 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 46 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0264413_108122 | 3300024493 | Bacteria | 2390 |
| 2 | Ga0264413_125253 | 3300024493 | Bacteria | 2606 |
| 3 | AustNasuHG_c1010221 | 3300000089 | Bacteria | 3275 |
| 4 | JGI24702J35022_10037111 | 3300002462 | Bacteria | 2603 |
| 5 | Ga0466711_129041 | 3300042615 | Bacteria | 2653 |
| 6 | Ga0466715_009698 | 3300042616 | Bacteria | 5972 |
| 7 | Ga0466715_146266 | 3300042616 | Bacteria | 5475 |
| 8 | Ga0466723_095884 | 3300042618 | Bacteria | 11307 |
| 9 | Ga0466726_153487 | 3300042619 | Bacteria | 1065 |
| 10 | Ga0466728_066814 | 3300042620 | Bacteria | 2032 |
| 11 | Ga0466707_132557 | 3300042601 | Bacteria | 1999 |
| 12 | Ga0466707_335352 | 3300042601 | Bacteria | 1866 |
| 13 | Ga0466716_105119 | 3300042605 | Bacteria | 8952 |
| 14 | Ga0466716_116779 | 3300042605 | Bacteria | 1071 |
| 15 | Ga0466720_021530 | 3300042607 | Unclassified | 2069 |
| 16 | Ga0466720_097858 | 3300042607 | Bacteria | 3626 |
| 17 | Ga0466720_190535 | 3300042607 | Bacteria | 7681 |
| 18 | Ga0466722_002676 | 3300042609 | Bacteria | 7623 |
| 19 | Ga0466705_026735 | 3300042612 | Bacteria | 1089 |
| 20 | Ga0466704_097099 | 3300042643 | Bacteria | 11160 |
| 21 | Ga0264413_116056 | 3300024493 | Bacteria | 5428 |
| 22 | Ga0264413_125247 | 3300024493 | Bacteria | 1659 |
| 23 | Ga0466691_077457 | 3300042593 | Bacteria | 7662 |
| 24 | Ga0074263_104671 | 3300005485 | Bacteria | 1431 |
| 25 | Ga0466705_451786 | 3300042612 | Bacteria | 10375 |
| 26 | Ga0466711_177408 | 3300042615 | Bacteria | 16419 |
| 27 | Ga0466715_125422 | 3300042616 | Bacteria | 12994 |
| 28 | Ga0466718_072399 | 3300042617 | Bacteria | 1332 |
| 29 | Ga0466706_174277 | 3300042599 | Bacteria | 1567 |
| 30 | Ga0466707_224081 | 3300042601 | Bacteria | 1831 |
| 31 | Ga0466716_410569 | 3300042605 | Bacteria | 6698 |
| 32 | Ga0466720_005720 | 3300042607 | Bacteria | 25391 |
| 33 | Ga0466720_070939 | 3300042607 | Bacteria | 7759 |
| 34 | Ga0466720_135890 | 3300042607 | Bacteria | 17742 |
| 35 | Ga0466720_179858 | 3300042607 | Bacteria | 3806 |
| 36 | Ga0466722_197311 | 3300042609 | Unclassified | 3351 |
| 37 | Ga0466703_016158 | 3300042636 | Bacteria | 2571 |
| 38 | Ga0466708_176951 | 3300042652 | Bacteria | 4059 |
| 39 | Ga0466708_337299 | 3300042652 | Bacteria | 14716 |
| 40 | Ga0264413_110741 | 3300024493 | Bacteria | 4389 |
| 41 | Ga0264413_128087 | 3300024493 | Bacteria | 2057 |
| 42 | Ga0466694_185269 | 3300042594 | Bacteria | 8031 |
| 43 | Ga0466732_232494 | 3300042656 | Bacteria | 12096 |
| 44 | FAAS_10000666 | 3300001880 | Bacteria | 1384 |
| 45 | JGI24702J35022_10031907 | 3300002462 | Unclassified | 2821 |
| 46 | Ga0466711_216604 | 3300042615 | Bacteria | 7560 |
| 47 | Ga0466711_439537 | 3300042615 | Bacteria | 2148 |
| 48 | Ga0466715_450562 | 3300042616 | Bacteria | 17198 |
| 49 | Ga0466718_110117 | 3300042617 | Bacteria | 4159 |
| 50 | Ga0466718_116198 | 3300042617 | Bacteria | 1714 |
| 51 | Ga0466728_074866 | 3300042620 | Bacteria | 6567 |
| 52 | Ga0466707_262939 | 3300042601 | Bacteria | 1986 |
| 53 | Ga0466717_290626 | 3300042604 | Archaea | 1952 |
| 54 | Ga0466716_098923 | 3300042605 | Bacteria | 15103 |
| 55 | Ga0466722_014375 | 3300042609 | Bacteria | 22202 |
| 56 | Ga0466722_107445 | 3300042609 | Bacteria | 6694 |
| 57 | Ga0466705_233621 | 3300042612 | Bacteria | 5538 |
| 58 | Ga0466705_316123 | 3300042612 | Bacteria | 19744 |
| 59 | Ga0466731_098750 | 3300042622 | Bacteria | 3556 |
| 60 | Ga0466731_332379 | 3300042622 | Bacteria | 3888 |
| 61 | Ga0466703_343173 | 3300042636 | Bacteria | 10884 |
| 62 | Ga0466709_049537 | 3300042648 | Bacteria | 7760 |
| 63 | Ga0466709_127489 | 3300042648 | Bacteria | 16562 |
| 64 | Ga0466696_131777 | 3300042596 | Bacteria | 5711 |
| 65 | AustNasuHG_c1000145 | 3300000089 | Bacteria | 22307 |
| 66 | Ga0466715_181245 | 3300042616 | Bacteria | 4620 |
| 67 | Ga0466720_064396 | 3300042607 | Bacteria | 4428 |
| 68 | Ga0466720_071220 | 3300042607 | Bacteria | 7252 |
| 69 | Ga0466720_120015 | 3300042607 | Unclassified | 7076 |
| 70 | Ga0466722_098958 | 3300042609 | Bacteria | 3637 |
| 71 | Ga0466698_380444 | 3300042610 | Bacteria | 5148 |
| 72 | Ga0466705_068720 | 3300042612 | Bacteria | 7452 |
| 73 | Ga0466705_133890 | 3300042612 | Bacteria | 8720 |
| 74 | Ga0466729_232034 | 3300042621 | Bacteria | 2400 |
| 75 | Ga0466735_161972 | 3300042624 | Bacteria | 1991 |
| 76 | Ga0466709_257784 | 3300042648 | Bacteria | 1262 |
| 77 | Ga0466694_026495 | 3300042594 | Bacteria | 3480 |
| 78 | Ga0466694_259295 | 3300042594 | Bacteria | 1042 |
| 79 | Ga0466711_197559 | 3300042615 | Bacteria | 53455 |
| 80 | Ga0466718_004299 | 3300042617 | Bacteria | 2025 |
| 81 | Ga0466718_016062 | 3300042617 | Bacteria | 5507 |
| 82 | Ga0466718_062241 | 3300042617 | Bacteria | 1666 |
| 83 | Ga0466718_077885 | 3300042617 | Bacteria | 9483 |
| 84 | Ga0466718_097749 | 3300042617 | Bacteria | 5967 |
| 85 | Ga0466723_111294 | 3300042618 | Bacteria | 2520 |
| 86 | Ga0466726_354722 | 3300042619 | Bacteria | 13701 |
| 87 | Ga0466706_283336 | 3300042599 | Bacteria | 1217 |
| 88 | Ga0466707_268384 | 3300042601 | Bacteria | 1235 |
| 89 | Ga0466716_224053 | 3300042605 | Bacteria | 6035 |
| 90 | Ga0466720_110415 | 3300042607 | Bacteria | 16866 |
| 91 | Ga0466722_142571 | 3300042609 | Bacteria | 7457 |
| 92 | Ga0466709_401065 | 3300042648 | Bacteria | 5210 |
| 93 | Ga0466708_160059 | 3300042652 | Bacteria | 8890 |
| 94 | Ga0466708_160120 | 3300042652 | Bacteria | 1673 |
| 95 | Ga0466727_092433 | 3300042655 | Bacteria | 40113 |
| 96 | Ga0264413_100076 | 3300024493 | Bacteria | 24181 |
| 97 | Ga0264413_108055 | 3300024493 | Bacteria | 4538 |
| 98 | Ga0466657_386531 | 3300042582 | Bacteria | 1112 |
| 99 | Ga0466694_015175 | 3300042594 | Bacteria | 7200 |
| 100 | Ga0466694_177524 | 3300042594 | Bacteria | 1504 |
| 101 | Ga0466696_238302 | 3300042596 | Bacteria | 11028 |
| 102 | Ga0466732_142488 | 3300042656 | Bacteria | 1333 |
| 103 | Ga0466732_337325 | 3300042656 | Bacteria | 3762 |
| 104 | JGI24698J34947_10128113 | 3300002449 | Bacteria | 1090 |
| 105 | Ga0072940_1030339 | 3300005200 | Bacteria | 3611 |
| 106 | Ga0074263_113376 | 3300005485 | Bacteria | 2142 |
| 107 | Ga0466715_031247 | 3300042616 | Bacteria | 31268 |
| 108 | Ga0466715_122381 | 3300042616 | Bacteria | 5187 |
| 109 | Ga0466718_074458 | 3300042617 | Bacteria | 1105 |
| 110 | Ga0466728_141928 | 3300042620 | Bacteria | 2874 |
| 111 | Ga0466719_016908 | 3300042606 | Bacteria | 25606 |
| 112 | Ga0466720_018298 | 3300042607 | Bacteria | 23483 |
| 113 | Ga0466720_082019 | 3300042607 | Bacteria | 6292 |
| 114 | Ga0466720_125851 | 3300042607 | Bacteria | 2158 |
| 115 | Ga0466720_134837 | 3300042607 | Bacteria | 4693 |
| 116 | Ga0466709_039543 | 3300042648 | Unclassified | 1572 |
| 117 | Ga0466709_265438 | 3300042648 | Bacteria | 6502 |
| 118 | Ga0466708_196549 | 3300042652 | Bacteria | 7521 |
| 119 | Ga0466692_034928 | 3300042591 | Bacteria | 20584 |
| 120 | Ga0466692_080961 | 3300042591 | Bacteria | 6650 |
| 121 | Ga0466692_200300 | 3300042591 | Bacteria | 1903 |
| 122 | Ga0466691_019584 | 3300042593 | Bacteria | 7137 |
| 123 | Ga0466691_098844 | 3300042593 | Bacteria | 2234 |
| 124 | JGI24698J34947_10089209 | 3300002449 | Bacteria | 1420 |
| 125 | Ga0466712_235861 | 3300042614 | Bacteria | 1253 |
| 126 | Ga0466711_424608 | 3300042615 | Bacteria | 1631 |
| 127 | Ga0466711_436993 | 3300042615 | Bacteria | 10720 |
| 128 | Ga0466715_081946 | 3300042616 | Bacteria | 10763 |
| 129 | Ga0466718_011214 | 3300042617 | Bacteria | 7458 |
| 130 | Ga0466718_080483 | 3300042617 | Bacteria | 17807 |
| 131 | Ga0466723_302599 | 3300042618 | Bacteria | 7494 |
| 132 | Ga0466726_489589 | 3300042619 | Bacteria | 1431 |
| 133 | Ga0466720_078233 | 3300042607 | Bacteria | 3002 |
| 134 | Ga0466722_193110 | 3300042609 | Bacteria | 14014 |
| 135 | Ga0466704_395512 | 3300042643 | Bacteria | 5314 |
| 136 | Ga0466708_301273 | 3300042652 | Bacteria | 1335 |
| 137 | Ga0264413_125455 | 3300024493 | Bacteria | 1269 |
| 138 | Ga0466690_090114 | 3300042590 | Bacteria | 3255 |
| 139 | Ga0466732_085805 | 3300042656 | Bacteria | 19532 |
| 140 | Ga0466732_206286 | 3300042656 | Bacteria | 2114 |
| 141 | Ga0466732_308420 | 3300042656 | Bacteria | 3730 |
| 142 | JGI24698J34947_10057930 | 3300002449 | Bacteria | 1920 |
| 143 | JGI24698J34947_10180007 | 3300002449 | Bacteria | 846 |
| 144 | Ga0072940_1022301 | 3300005200 | Bacteria | 6874 |
| 145 | Ga0466715_148608 | 3300042616 | Bacteria | 20383 |
| 146 | Ga0466718_077793 | 3300042617 | Bacteria | 1225 |
| 147 | Ga0466728_313533 | 3300042620 | Bacteria | 23060 |
| 148 | Ga0123353_10313312 | 3300010167 | Bacteria | 2386 |
| 149 | Ga0466707_056233 | 3300042601 | Bacteria | 7116 |
| 150 | Ga0466720_053804 | 3300042607 | Bacteria | 29860 |
| 151 | Ga0466720_098368 | 3300042607 | Bacteria | 20163 |
| 152 | Ga0466731_275951 | 3300042622 | Bacteria | 5387 |
| 153 | Ga0466735_085860 | 3300042624 | Bacteria | 1267 |
| 154 | Ga0466704_035772 | 3300042643 | Bacteria | 22838 |
| 155 | Ga0466704_247086 | 3300042643 | Bacteria | 6578 |
| 156 | Ga0466727_110731 | 3300042655 | Unclassified | 1880 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF04060 | FeS | Putative Fe-S cluster | 44 | 75 | 0.97 |
| PF12838 | Fer4_7 | 4Fe-4S dicluster domain | 218 | 261 | 0.95 |
| PF00037 | Fer4 | 4Fe-4S binding domain | 164 | 187 | 0.94 |
| PF12837 | Fer4_6 | 4Fe-4S binding domain | 164 | 186 | 0.94 |
| PF14697 | Fer4_21 | 4Fe-4S dicluster domain | 141 | 186 | 0.93 |
| PF13187 | Fer4_9 | 4Fe-4S dicluster domain | 218 | 260 | 0.93 |
| PF13237 | Fer4_10 | 4Fe-4S dicluster domain | 165 | 195 | 0.72 |
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF04060 | GO:0051536 | iron-sulfur cluster binding | MF |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.