Protein Family IF13033

Metagenome Isolate
125 Members
56 Samples
98 Scaffolds
477.89 Avg Length

🧬 Representative Sequence

ID
iso_pr_bacteria|2923982719|2923984598|
Length
512 aa
Sequence
MAKNYRIPVKRFITSMTNYTQYLLRIKRINTYTMKELNKETAPKTSYPERIIQFGEGNFLRAFADWMIQVMNEKTDFNSSVVVVQPIENGMVDMLNKQDCLYHVNLQGLDKGEKVNSLTRVDVISRALNPYKEYEAFIKLAEQPEIRFVISNTTEAGIVFDPSCKLTDAPASSYPGKLTQLLYHRFQTFHADKDKGLIIFPCELIFLNGHKLKETIYQYIAHWNLGKEFETWFTEACGVYATLVDRIVPGFPRKEIDVIKEKLQYNDNLVVQAEIFHLWVIEAPQSVAKEFPADKAGLNVLFVPSEEPYHQRKVTLLNGPHTVLAPVTYLSGVDIVRDACQHEVLGKYIHKVMFDELLETLDLPKEELVQFGQDVLERFNNPFVDHSVVSIMLNSFPKYATRDLPGLKVYLERKGKLPEGLVLGLAAIMTYYKGGYRADGAACEPNDAPEILQLFKELWATGSNCKVAEGGLGASFIWGEDLNLITGLTDKLTSYLDIIQEKGMLNVVKEII

📊 Sample Types

Isolate 21.6%
Metagenome 78.4%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Blattidae 44.4%
Kalotermitidae 25.9%
Rhinotermitidae 7.4%
Termopsidae 7.4%
Unclassified 7.4%
Termitidae 5.6%
Hodotermitidae 1.9%

🌳 Taxonomy

Archaea 0
Bacteria 122
Eukaryota 0
Viruses 0
Unclassified 3

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2609459943 Bacteroides reticulotermitis JCM 10512 Isolate Rhinotermitidae
2 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
3 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
4 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
5 3300024582 Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 Metagenome
6 2940199050 Parabacteroides sp. PM6-13 Isolate Blattidae
7 2940371297 Parabacteroides sp. PM5-20 Isolate Blattidae
8 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
9 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
10 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
11 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
12 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
13 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
14 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
15 2820762746 Unclassified Bacteroidetes Mp193P4bin3 Isolate Unclassified
16 2920168565 Paludibacter sp. 221 Isolate Blattidae
17 2940205530 Parabacteroides sp. PH5-33 Isolate Blattidae
18 2940317558 Parabacteroides sp. PH5-26 Isolate Blattidae
19 2940325180 Parabacteroides sp. PH5-41 Isolate Blattidae
20 3004672520 Bacteroides sp. 51 Isolate Blattidae
21 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
22 2830041218 Bacteroides reticulotermitis DSM 105720 Isolate Unclassified
23 2940212447 Parabacteroides sp. PH5-16 Isolate Blattidae
24 2940302308 Parabacteroides sp. PF5-5 Isolate Blattidae
25 2940321370 Parabacteroides sp. PH5-39 Isolate Blattidae
26 2940332795 Parabacteroides sp. PH5-8 Isolate Blattidae
27 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
28 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
29 2910959314 Dysgonomonas sp. 511 Isolate Blattidae
30 2923982719 Parabacteroides sp. 52 Isolate Blattidae
31 2940306115 Parabacteroides sp. PFB2-22 Isolate Blattidae
32 2940309933 Parabacteroides sp. PH5-13 Isolate Blattidae
33 2940328985 Parabacteroides sp. PH5-46 Isolate Blattidae
34 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
35 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
36 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
37 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
38 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
39 3004677695 Bacteroides sp. 214 Isolate Blattidae
40 2940346213 Parabacteroides sp. PFB2-12 Isolate Blattidae
41 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
42 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
43 2922326829 Bacteroides sp. 224 Isolate Blattidae
44 2940313741 Parabacteroides sp. PH5-17 Isolate Blattidae
45 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
46 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
47 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
48 3004667792 Bacteroides sp. 519 Isolate Blattidae
49 2940195863 Parabacteroides sp. PF5-6 Isolate Blattidae
50 2940209341 Parabacteroides sp. PFB2-10 Isolate Blattidae
51 2940298504 Parabacteroides sp. PF5-13 Isolate Blattidae
52 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
53 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
54 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
55 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
56 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_375019 3300042612 Bacteria 7696
2 Ga0466691_100125 3300042593 Bacteria 37337
3 Ga0466696_464977 3300042596 Bacteria 1865
4 Ga0466711_337967 3300042615 Bacteria 12586
5 Ga0466715_130853 3300042616 Bacteria 14868
6 Ga0466723_133687 3300042618 Bacteria 11953
7 Ga0466723_183847 3300042618 Bacteria 12292
8 Ga0466729_221109 3300042621 Bacteria 9058
9 Ga0466704_253788 3300042643 Bacteria 19909
10 Ga0466708_198288 3300042652 Bacteria 6798
11 Ga0466706_027167 3300042599 Bacteria 39836
12 Ga0466714_041855 3300042603 Bacteria 7411
13 Ga0466690_082716 3300042590 Bacteria 3326
14 Ga0466690_167924 3300042590 Bacteria 15969
15 Ga0466692_006975 3300042591 Bacteria 5062
16 Ga0466691_044940 3300042593 Bacteria 6547
17 Ga0466723_094741 3300042618 Bacteria 15823
18 Ga0466726_466285 3300042619 Unclassified 1703
19 Ga0466704_603076 3300042643 Bacteria 34589
20 Ga0466709_199923 3300042648 Bacteria 96862
21 Ga0068302_10565736 3300005071 Bacteria 2169
22 Ga0466690_211331 3300042590 Bacteria 24882
23 Ga0466696_486712 3300042596 Bacteria 3366
24 Ga0466696_500415 3300042596 Bacteria 13696
25 Ga0466723_059005 3300042618 Bacteria 62633
26 Ga0466728_119303 3300042620 Bacteria 6036
27 Ga0466728_377769 3300042620 Bacteria 9387
28 Ga0466735_008785 3300042624 Bacteria 7437
29 Ga0466735_227761 3300042624 Bacteria 1936
30 Ga0466703_004863 3300042636 Bacteria 11962
31 Ga0466703_206818 3300042636 Bacteria 4106
32 Ga0466704_168253 3300042643 Bacteria 34036
33 Ga0466706_191859 3300042599 Bacteria 15406
34 Ga0466707_258930 3300042601 Bacteria 22459
35 Ga0466722_085480 3300042609 Bacteria 10710
36 Ga0466705_342178 3300042612 Bacteria 42153
37 Ga0072941_1390810 3300005201 Bacteria 3062
38 Ga0466690_068702 3300042590 Bacteria 28629
39 Ga0466690_191714 3300042590 Bacteria 10531
40 Ga0466690_241549 3300042590 Bacteria 6321
41 Ga0466691_008552 3300042593 Bacteria 6511
42 Ga0466696_063888 3300042596 Bacteria 3886
43 Ga0466696_123377 3300042596 Bacteria 5080
44 Ga0466696_129544 3300042596 Bacteria 2300
45 Ga0466696_172325 3300042596 Bacteria 37657
46 Ga0466715_226670 3300042616 Bacteria 6835
47 Ga0466723_050299 3300042618 Bacteria 13082
48 Ga0466726_023136 3300042619 Bacteria 4280
49 Ga0466726_108764 3300042619 Bacteria 11715
50 Ga0466735_034592 3300042624 Bacteria 8725
51 Ga0466719_444059 3300042606 Bacteria 1865
52 Ga0466722_013429 3300042609 Bacteria 3456
53 Ga0466733_130688 3300042659 Bacteria 23826
54 Ga0068302_10052783 3300005071 Bacteria 1777
55 Ga0068305_10002010 3300005083 Bacteria 184777
56 Ga0265387_1001797 3300024582 Bacteria 3071
57 Ga0466690_034127 3300042590 Bacteria 10198
58 Ga0466691_048668 3300042593 Bacteria 5113
59 Ga0466705_448784 3300042612 Bacteria 15524
60 Ga0466704_008871 3300042643 Bacteria 7878
61 Ga0466727_021199 3300042655 Bacteria 2810
62 Ga0466727_207929 3300042655 Bacteria 5074
63 Ga0466705_028542 3300042612 Bacteria 3602
64 Ga0466690_128650 3300042590 Bacteria 3535
65 Ga0466723_005478 3300042618 Bacteria 26749
66 Ga0466723_088575 3300042618 Bacteria 7062
67 Ga0466723_129862 3300042618 Bacteria 5318
68 Ga0466728_073725 3300042620 Bacteria 64638
69 Ga0466708_263041 3300042652 Bacteria 7617
70 Ga0466706_073929 3300042599 Bacteria 62218
71 Ga0466716_075443 3300042605 Bacteria 4825
72 Ga0466705_048505 3300042612 Bacteria 1651
73 Ga0466733_161084 3300042659 Bacteria 8174
74 Ga0466690_172738 3300042590 Bacteria 57212
75 Ga0466696_135386 3300042596 Bacteria 3486
76 Ga0466728_095021 3300042620 Bacteria 12976
77 Ga0466735_029550 3300042624 Bacteria 5603
78 Ga0466709_414115 3300042648 Bacteria 5627
79 Ga0466708_148006 3300042652 Bacteria 3730
80 Ga0466708_388127 3300042652 Bacteria 20862
81 Ga0466727_251974 3300042655 Bacteria 41475
82 Ga0466706_116680 3300042599 Bacteria 6775
83 Ga0466706_166355 3300042599 Bacteria 2250
84 Ga0466707_161230 3300042601 Unclassified 6730
85 Ga0466707_197646 3300042601 Bacteria 16993
86 Ga0466714_051455 3300042603 Bacteria 64684
87 Ga0466719_295613 3300042606 Bacteria 4609
88 Ga0466733_051179 3300042659 Bacteria 7147
89 JGI24699J35502_11134204 3300002509 Bacteria 55998
90 Ga0466692_125029 3300042591 Bacteria 3623
91 Ga0466696_340445 3300042596 Bacteria 3926
92 Ga0466726_418653 3300042619 Bacteria 12621
93 Ga0466728_007545 3300042620 Bacteria 5767
94 Ga0466735_141629 3300042624 Bacteria 6302
95 Ga0466706_078296 3300042599 Bacteria 2551
96 Ga0466706_166994 3300042599 Bacteria 2469
97 Ga0466707_078115 3300042601 Unclassified 2149
98 Ga0466716_202760 3300042605 Bacteria 21677

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF01232 Mannitol_dh Mannitol dehydrogenase Rossmann domain 49 291 0.95
PF08125 Mannitol_dh_C Mannitol dehydrogenase C-terminal domain 307 456 0.82

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF01232 GO:0016491 oxidoreductase activity MF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.