Protein Family IF13003
Metagenome
Isolate
160
Members
73
Samples
131
Scaffolds
270.81
Avg Length
Representative Sequence
- ID
- iso_pr_bacteria|2910942425|2910943177|
- Length
- 290 aa
- Sequence
- MGESNEGMTFWDHLEELRWTLVRSIIALFVFAIIAFALMPYIYDSWIMGATRADFVLYKYLCYATSAIPFLPDFCDDTFHIKIINYNLTSQFFRHMTTSFWLALILTFPYLVFEIWRFVSPALYASERKSIRWVALFGTGMFFVGCAVGYFLVFPMTFRFLATYQLSEMIENTISLDSYMDNFLILIFIMGIVFELPLVSWLLSQLGLLNRSFFKKFRRHAIVGLLVLSAFITPSSDPFTLSVVFIPLYLLFELSRFMVKPAPKETDEDEEDEEEEELDEDTPDIQIESK
Sample Types
Isolate
18.1%
Metagenome
81.9%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Blattidae
35.2%
Termitidae
23.9%
Kalotermitidae
18.3%
Unclassified
7.0%
Rhinotermitidae
5.6%
Passalidae
4.2%
Termopsidae
4.2%
Drosophilidae
1.4%
Taxonomy
Archaea
0
Bacteria
149
Eukaryota
0
Viruses
0
Unclassified
11
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2904728850 | Flavobacterium sp. xlx-214 | Isolate | |
| 2 | 2940199050 | Parabacteroides sp. PM6-13 | Isolate | Blattidae |
| 3 | 2940202316 | Parabacteroides sp. PF5-9 | Isolate | Blattidae |
| 4 | 2940371297 | Parabacteroides sp. PM5-20 | Isolate | Blattidae |
| 5 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 6 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 7 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 8 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 9 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 10 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 11 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 12 | 2820759988 | Unclassified Bacteroidetes Mp193P4bin4 | Isolate | Unclassified |
| 13 | 2910959314 | Dysgonomonas sp. 511 | Isolate | Blattidae |
| 14 | 2923982719 | Parabacteroides sp. 52 | Isolate | Blattidae |
| 15 | 2940306115 | Parabacteroides sp. PFB2-22 | Isolate | Blattidae |
| 16 | 2940309933 | Parabacteroides sp. PH5-13 | Isolate | Blattidae |
| 17 | 2940328985 | Parabacteroides sp. PH5-46 | Isolate | Blattidae |
| 18 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 19 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 20 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 21 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 22 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 23 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 24 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 25 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 26 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 27 | 2695420314 | Dysgonomonas sp. BGC7 | Isolate | Unclassified |
| 28 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 29 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 30 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 31 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 32 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 33 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 34 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 35 | 2940253009 | Dysgonomonas sp. PF1-23 | Isolate | Blattidae |
| 36 | 2940257232 | Dysgonomonas sp. PFB1-18 | Isolate | Blattidae |
| 37 | 2940313741 | Parabacteroides sp. PH5-17 | Isolate | Blattidae |
| 38 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 39 | 3300007085 | Drosophila gut microbial communities from New York, USA - Drosophila neotestacea male 3 gut | Metagenome | Drosophilidae |
| 40 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 41 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 42 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 43 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 44 | 2940205530 | Parabacteroides sp. PH5-33 | Isolate | Blattidae |
| 45 | 2940317558 | Parabacteroides sp. PH5-26 | Isolate | Blattidae |
| 46 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 47 | 2225789003 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) | Metagenome | Passalidae |
| 48 | 2910942425 | Dysgonomonas sp. 521 | Isolate | Blattidae |
| 49 | 2940212447 | Parabacteroides sp. PH5-16 | Isolate | Blattidae |
| 50 | 2940244548 | Dysgonomonas sp. PF1-14 | Isolate | Blattidae |
| 51 | 2940302308 | Parabacteroides sp. PF5-5 | Isolate | Blattidae |
| 52 | 2940321370 | Parabacteroides sp. PH5-39 | Isolate | Blattidae |
| 53 | 2940332795 | Parabacteroides sp. PH5-8 | Isolate | Blattidae |
| 54 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 55 | 8100166142 | Dysgonomonas sp. GY75 | Isolate | Rhinotermitidae |
| 56 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 57 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 58 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 59 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 60 | 2910926975 | Dysgonomonas sp. 25 | Isolate | Blattidae |
| 61 | 2940195863 | Parabacteroides sp. PF5-6 | Isolate | Blattidae |
| 62 | 2940209341 | Parabacteroides sp. PFB2-10 | Isolate | Blattidae |
| 63 | 2940298504 | Parabacteroides sp. PF5-13 | Isolate | Blattidae |
| 64 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 65 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 66 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 67 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 68 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 69 | 2940248789 | Dysgonomonas sp. PF1-16 | Isolate | Blattidae |
| 70 | 2940346213 | Parabacteroides sp. PFB2-12 | Isolate | Blattidae |
| 71 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 72 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 73 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0123357_10004268 | 3300009784 | Bacteria | 16708 |
| 2 | Ga0466713_045668 | 3300042602 | Unclassified | 12327 |
| 3 | Ga0466713_128667 | 3300042602 | Bacteria | 14413 |
| 4 | Ga0466719_033464 | 3300042606 | Bacteria | 10139 |
| 5 | Ga0466719_473979 | 3300042606 | Bacteria | 11116 |
| 6 | Ga0466722_066081 | 3300042609 | Bacteria | 17837 |
| 7 | Ga0466735_105895 | 3300042624 | Bacteria | 4329 |
| 8 | Ga0466692_076471 | 3300042591 | Unclassified | 1473 |
| 9 | Ga0466691_094593 | 3300042593 | Bacteria | 62434 |
| 10 | Ga0466696_437564 | 3300042596 | Bacteria | 6236 |
| 11 | Ga0466728_296388 | 3300042620 | Bacteria | 3321 |
| 12 | 2227074391 | 2225789003 | Bacteria | 2382 |
| 13 | 2227225264 | 2225789004 | Unclassified | 7408 |
| 14 | IMNBL1DRAFT_c0000786 | 3300000062 | Bacteria | 25019 |
| 15 | Ga0068305_10024548 | 3300005083 | Unclassified | 1237 |
| 16 | Ga0068305_10329646 | 3300005083 | Bacteria | 1875 |
| 17 | Ga0466697_272204 | 3300042611 | Bacteria | 3019 |
| 18 | Ga0466713_017563 | 3300042602 | Bacteria | 1665 |
| 19 | Ga0466735_185111 | 3300042624 | Bacteria | 2532 |
| 20 | Ga0466703_225187 | 3300042636 | Bacteria | 7487 |
| 21 | Ga0466696_268501 | 3300042596 | Bacteria | 3850 |
| 22 | Ga0466711_060197 | 3300042615 | Bacteria | 5859 |
| 23 | Ga0104045_1004415 | 3300007085 | Bacteria | 5530 |
| 24 | Ga0123357_10000905 | 3300009784 | Bacteria | 30212 |
| 25 | Ga0466707_080227 | 3300042601 | Bacteria | 11157 |
| 26 | Ga0466713_016019 | 3300042602 | Bacteria | 439221 |
| 27 | Ga0466713_087612 | 3300042602 | Bacteria | 10667 |
| 28 | Ga0466716_169373 | 3300042605 | Unclassified | 2570 |
| 29 | Ga0466716_429759 | 3300042605 | Bacteria | 21627 |
| 30 | Ga0466703_176599 | 3300042636 | Bacteria | 6647 |
| 31 | Ga0466703_322198 | 3300042636 | Bacteria | 4235 |
| 32 | Ga0466709_277407 | 3300042648 | Bacteria | 5746 |
| 33 | Ga0466727_333073 | 3300042655 | Bacteria | 5525 |
| 34 | Ga0466690_099393 | 3300042590 | Bacteria | 94849 |
| 35 | Ga0466690_286024 | 3300042590 | Bacteria | 10851 |
| 36 | Ga0466690_309283 | 3300042590 | Bacteria | 99610 |
| 37 | Ga0466711_427197 | 3300042615 | Bacteria | 2816 |
| 38 | Ga0466728_125360 | 3300042620 | Bacteria | 1465 |
| 39 | Ga0466733_140244 | 3300042659 | Bacteria | 40358 |
| 40 | Ga0466733_199413 | 3300042659 | Bacteria | 13276 |
| 41 | Ga0123354_10004213 | 3300010882 | Bacteria | 20291 |
| 42 | Ga0123354_10191072 | 3300010882 | Bacteria | 2292 |
| 43 | Ga0466707_156843 | 3300042601 | Bacteria | 20390 |
| 44 | Ga0466713_007739 | 3300042602 | Bacteria | 4886 |
| 45 | Ga0466735_129555 | 3300042624 | Bacteria | 1770 |
| 46 | Ga0466735_154266 | 3300042624 | Bacteria | 2200 |
| 47 | Ga0466709_391962 | 3300042648 | Bacteria | 3332 |
| 48 | Ga0466711_037378 | 3300042615 | Bacteria | 10513 |
| 49 | Ga0466711_277688 | 3300042615 | Bacteria | 14398 |
| 50 | Ga0466723_097040 | 3300042618 | Bacteria | 7599 |
| 51 | IMNBL1DRAFT_c0002069 | 3300000062 | Bacteria | 14322 |
| 52 | JGI24702J35022_10009292 | 3300002462 | Bacteria | 5523 |
| 53 | Ga0068305_10050721 | 3300005083 | Bacteria | 10043 |
| 54 | Ga0466705_000780 | 3300042612 | Bacteria | 13087 |
| 55 | Ga0466707_162314 | 3300042601 | Bacteria | 2537 |
| 56 | Ga0466707_243595 | 3300042601 | Bacteria | 19927 |
| 57 | Ga0466713_130991 | 3300042602 | Bacteria | 214088 |
| 58 | Ga0466714_120217 | 3300042603 | Bacteria | 1986 |
| 59 | Ga0466719_499305 | 3300042606 | Bacteria | 4984 |
| 60 | Ga0466725_406618 | 3300042654 | Bacteria | 3592 |
| 61 | Ga0466727_266935 | 3300042655 | Bacteria | 5415 |
| 62 | Ga0466690_041397 | 3300042590 | Bacteria | 9026 |
| 63 | Ga0466696_247839 | 3300042596 | Bacteria | 4744 |
| 64 | Ga0466705_401640 | 3300042612 | Bacteria | 8462 |
| 65 | Ga0466711_468263 | 3300042615 | Bacteria | 1341 |
| 66 | Ga0466715_268476 | 3300042616 | Bacteria | 54264 |
| 67 | Ga0466728_106770 | 3300042620 | Bacteria | 3615 |
| 68 | Ga0072941_1060164 | 3300005201 | Bacteria | 9635 |
| 69 | Ga0466705_132056 | 3300042612 | Bacteria | 1616 |
| 70 | Ga0466733_000451 | 3300042659 | Bacteria | 10773 |
| 71 | Ga0123357_10229056 | 3300009784 | Bacteria | 2042 |
| 72 | Ga0466701_084460 | 3300042598 | Bacteria | 6172 |
| 73 | Ga0466707_143391 | 3300042601 | Bacteria | 9531 |
| 74 | Ga0466707_216153 | 3300042601 | Bacteria | 12620 |
| 75 | Ga0466713_008757 | 3300042602 | Bacteria | 124939 |
| 76 | Ga0466713_041013 | 3300042602 | Bacteria | 31505 |
| 77 | Ga0466719_224656 | 3300042606 | Bacteria | 2686 |
| 78 | Ga0466722_196657 | 3300042609 | Bacteria | 12949 |
| 79 | Ga0466722_238486 | 3300042609 | Bacteria | 6306 |
| 80 | Ga0466735_120018 | 3300042624 | Unclassified | 4791 |
| 81 | Ga0466730_071930 | 3300042625 | Bacteria | 8946 |
| 82 | Ga0466703_125567 | 3300042636 | Bacteria | 8716 |
| 83 | Ga0466704_134165 | 3300042643 | Bacteria | 8681 |
| 84 | Ga0466704_561838 | 3300042643 | Bacteria | 29338 |
| 85 | Ga0466709_137811 | 3300042648 | Bacteria | 185438 |
| 86 | Ga0466711_228470 | 3300042615 | Bacteria | 16578 |
| 87 | Ga0466715_234130 | 3300042616 | Bacteria | 12638 |
| 88 | Ga0466726_379624 | 3300042619 | Bacteria | 5228 |
| 89 | JGI24702J35022_10023130 | 3300002462 | Bacteria | 3360 |
| 90 | Ga0466733_026023 | 3300042659 | Bacteria | 19249 |
| 91 | Ga0466733_192802 | 3300042659 | Bacteria | 54728 |
| 92 | Ga0123357_10404000 | 3300009784 | Bacteria | 1239 |
| 93 | Ga0466716_081039 | 3300042605 | Bacteria | 7734 |
| 94 | Ga0466716_472962 | 3300042605 | Bacteria | 14290 |
| 95 | Ga0466719_530556 | 3300042606 | Bacteria | 4125 |
| 96 | Ga0466722_126170 | 3300042609 | Bacteria | 47921 |
| 97 | Ga0466729_244985 | 3300042621 | Unclassified | 2364 |
| 98 | Ga0466729_297621 | 3300042621 | Bacteria | 12032 |
| 99 | Ga0466734_014198 | 3300042623 | Bacteria | 13866 |
| 100 | Ga0466704_020582 | 3300042643 | Bacteria | 6997 |
| 101 | Ga0466656_284175 | 3300042550 | Bacteria | 1517 |
| 102 | Ga0466657_359998 | 3300042582 | Bacteria | 2320 |
| 103 | Ga0466692_157216 | 3300042591 | Bacteria | 2766 |
| 104 | Ga0466715_106361 | 3300042616 | Bacteria | 10792 |
| 105 | Ga0466715_212228 | 3300042616 | Bacteria | 5987 |
| 106 | Ga0466715_420888 | 3300042616 | Unclassified | 23059 |
| 107 | Ga0466705_013928 | 3300042612 | Unclassified | 5190 |
| 108 | Ga0466705_251419 | 3300042612 | Bacteria | 9858 |
| 109 | Ga0466705_311982 | 3300042612 | Bacteria | 1717 |
| 110 | Ga0466733_023719 | 3300042659 | Bacteria | 14583 |
| 111 | Ga0466733_040837 | 3300042659 | Bacteria | 12358 |
| 112 | Ga0123356_10101213 | 3300010049 | Bacteria | 2764 |
| 113 | Ga0466700_477570 | 3300042600 | Bacteria | 28301 |
| 114 | Ga0466707_286757 | 3300042601 | Bacteria | 9210 |
| 115 | Ga0466713_016043 | 3300042602 | Bacteria | 6360 |
| 116 | Ga0466722_011775 | 3300042609 | Bacteria | 7225 |
| 117 | Ga0466698_173030 | 3300042610 | Bacteria | 1401 |
| 118 | Ga0466735_013123 | 3300042624 | Bacteria | 24815 |
| 119 | Ga0466735_085095 | 3300042624 | Unclassified | 1523 |
| 120 | Ga0466703_216789 | 3300042636 | Bacteria | 3502 |
| 121 | Ga0466704_099264 | 3300042643 | Bacteria | 2230 |
| 122 | Ga0466704_119794 | 3300042643 | Bacteria | 2134 |
| 123 | Ga0466693_352370 | 3300042592 | Bacteria | 1532 |
| 124 | Ga0466696_036064 | 3300042596 | Bacteria | 108856 |
| 125 | Ga0466711_071217 | 3300042615 | Unclassified | 1213 |
| 126 | Ga0466723_343279 | 3300042618 | Bacteria | 10940 |
| 127 | Ga0466729_027298 | 3300042621 | Bacteria | 8165 |
| 128 | Ga0466729_157287 | 3300042621 | Bacteria | 14619 |
| 129 | IMNBL1DRAFT_c0012737 | 3300000062 | Bacteria | 3825 |
| 130 | JGI24702J35022_10001220 | 3300002462 | Bacteria | 15998 |
| 131 | JGI24696J40584_12959270 | 3300002834 | Bacteria | 4924 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00902 | TatC | Sec-independent protein translocase protein (TatC) | 12 | 247 | 0.94 |
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF00902 | GO:0016020 | membrane | CC |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.