Protein Family IF12572
Metagenome
Isolate
142
Members
58
Samples
128
Scaffolds
437.95
Avg Length
Representative Sequence
- ID
- iso_pr_bacteria|2861449170|2861450907|
- Length
- 476 aa
- Sequence
- MTDLRAGQRPAAHCSPQVDIKTAFRAAQRLGVVFFPAFDWAISATHPEREERLLYTRDQLVEEGLFDIPGITEYRPSFASHAQLERVHFCLPTARAVSTDSHLAAAGGAIRAARLVLEGHEDRAFALVRPPGHHAMRVVHGNRGFCNINNEAVMVEYIRDNYPRPDGRPLRIAIVDTDVHHGDGTQDVFWNDPHTLFISLHQDGRTLYPGTGFLKECGGPGALGRTINIPLPPETSDEGYLYAIEHAVLPILEDFKPDFIINSAGQDNHFTDPLANMKLSAQGYAALTKLLNPHVAVLEGGYSIRGALPYVNLGICMALAGLDAGDIREPGWTPKATRQDPKVGQYIARLCEQVRDCYFNPPAEPFEGRVEGRGQDSWWVRQKHIFYDTDMLSEGQTEAWRLCPDCSGLGRIETASERVARSLCVLIPRHACPACRAKGQEVAAEGHKAGRHAHIIVLDGNAANIATAAGDDLLRV
Sample Types
Isolate
9.9%
Metagenome
90.1%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
30.4%
Unclassified
26.8%
Kalotermitidae
25.0%
Rhinotermitidae
7.1%
Termopsidae
5.4%
Passalidae
3.6%
Hodotermitidae
1.8%
Taxonomy
Archaea
2
Bacteria
139
Eukaryota
0
Viruses
0
Unclassified
1
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820056190 | Unclassified Proteobacteria Nt197P4bin9 | Isolate | Unclassified |
| 2 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 3 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 4 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 5 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 6 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 7 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 8 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 9 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 10 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 11 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 12 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 13 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 14 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 15 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 16 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 17 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 18 | 2820080004 | Unclassified Proteobacteria Lab288P4bin34 | Isolate | Unclassified |
| 19 | 2820364642 | Unclassified Firmicutes Nt197P3bin107 | Isolate | Unclassified |
| 20 | 2820641689 | Unclassified Firmicutes Cu122P5bin5 | Isolate | Unclassified |
| 21 | 2820155744 | Unclassified Proteobacteria Cu122P5bin24 | Isolate | Unclassified |
| 22 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 23 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 24 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 25 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 26 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 27 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 28 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 29 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 30 | 2820010479 | Unclassified Spirochaetes Th196P4bin55 | Isolate | Unclassified |
| 31 | 2820350530 | Unclassified Firmicutes Nt197P3bin37 | Isolate | Unclassified |
| 32 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 33 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 34 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 35 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 36 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 37 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 38 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 39 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 40 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 41 | 2820094617 | Unclassified Proteobacteria Lab288P3bin216 | Isolate | Unclassified |
| 42 | 2820101058 | Unclassified Proteobacteria Emb289P4bin76 | Isolate | Unclassified |
| 43 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 44 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 45 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 46 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 47 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 48 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 49 | 2861449170 | Desulfovibrio intestinalis DSM 11275 | Isolate | Unclassified |
| 50 | 2758568796 | Unclassified Deltaproteobacteria Th196P3_bin21 | Isolate | Unclassified |
| 51 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 52 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 53 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 54 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 55 | 2508501043 | Desulfovibrio termitidis HI1 | Isolate | Rhinotermitidae |
| 56 | 2636416028 | Pelosinus propionicus DSM 13327 | Isolate | Unclassified |
| 57 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 58 | 2989309576 | Sporomusa termitida DSM 4440 | Isolate | Unclassified |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_185592 | 3300042612 | Bacteria | 133507 |
| 2 | Ga0466710_404674 | 3300042613 | Bacteria | 66035 |
| 3 | Ga0466715_186370 | 3300042616 | Bacteria | 15273 |
| 4 | Ga0466723_023935 | 3300042618 | Bacteria | 14485 |
| 5 | Ga0466723_348446 | 3300042618 | Bacteria | 1925 |
| 6 | Ga0466728_356950 | 3300042620 | Bacteria | 22300 |
| 7 | Ga0466728_471288 | 3300042620 | Bacteria | 2634 |
| 8 | Ga0466707_067601 | 3300042601 | Bacteria | 29012 |
| 9 | Ga0466719_247400 | 3300042606 | Bacteria | 1704 |
| 10 | Ga0123353_10009360 | 3300010167 | Bacteria | 13508 |
| 11 | Ga0123354_10058648 | 3300010882 | Bacteria | 5717 |
| 12 | Ga0466692_081883 | 3300042591 | Bacteria | 32595 |
| 13 | Ga0466696_104160 | 3300042596 | Bacteria | 6116 |
| 14 | Ga0072940_1123001 | 3300005200 | Bacteria | 2172 |
| 15 | Ga0466735_019825 | 3300042624 | Bacteria | 1588 |
| 16 | Ga0466735_229392 | 3300042624 | Bacteria | 12212 |
| 17 | Ga0466705_058318 | 3300042612 | Bacteria | 18217 |
| 18 | Ga0466711_432184 | 3300042615 | Bacteria | 97958 |
| 19 | Ga0466715_070036 | 3300042616 | Bacteria | 12808 |
| 20 | Ga0466715_177287 | 3300042616 | Bacteria | 11365 |
| 21 | Ga0466723_086950 | 3300042618 | Bacteria | 23303 |
| 22 | Ga0466728_071113 | 3300042620 | Bacteria | 19333 |
| 23 | Ga0466716_051155 | 3300042605 | Bacteria | 9106 |
| 24 | Ga0466698_211593 | 3300042610 | Bacteria | 3509 |
| 25 | Ga0123353_10059313 | 3300010167 | Bacteria | 6135 |
| 26 | Ga0123354_10001990 | 3300010882 | Bacteria | 26215 |
| 27 | Ga0068302_10051838 | 3300005071 | Bacteria | 2968 |
| 28 | Ga0466731_079368 | 3300042622 | Bacteria | 3240 |
| 29 | Ga0466703_207716 | 3300042636 | Bacteria | 1846 |
| 30 | Ga0466705_487824 | 3300042612 | Bacteria | 14212 |
| 31 | Ga0466723_161339 | 3300042618 | Bacteria | 3264 |
| 32 | Ga0466723_172097 | 3300042618 | Bacteria | 2296 |
| 33 | Ga0466728_006508 | 3300042620 | Bacteria | 3569 |
| 34 | Ga0466728_204646 | 3300042620 | Bacteria | 11283 |
| 35 | Ga0466729_189631 | 3300042621 | Bacteria | 3492 |
| 36 | Ga0466716_176271 | 3300042605 | Bacteria | 14764 |
| 37 | Ga0466722_250294 | 3300042609 | Bacteria | 70396 |
| 38 | Ga0123357_10004046 | 3300009784 | Bacteria | 17065 |
| 39 | Ga0123357_10067266 | 3300009784 | Bacteria | 4774 |
| 40 | Ga0123353_10037200 | 3300010167 | Bacteria | 7633 |
| 41 | Ga0123353_10522817 | 3300010167 | Archaea | 1721 |
| 42 | Ga0466691_019036 | 3300042593 | Bacteria | 9540 |
| 43 | IMNBL1DRAFT_c0011950 | 3300000062 | Bacteria | 4007 |
| 44 | JGI24705J35276_12235332 | 3300002504 | Bacteria | 6425 |
| 45 | Ga0466703_244903 | 3300042636 | Bacteria | 10029 |
| 46 | Ga0466708_452204 | 3300042652 | Bacteria | 148002 |
| 47 | Ga0466705_127329 | 3300042612 | Bacteria | 20991 |
| 48 | Ga0466711_000294 | 3300042615 | Bacteria | 13225 |
| 49 | Ga0466711_357768 | 3300042615 | Archaea | 5330 |
| 50 | Ga0466715_037134 | 3300042616 | Bacteria | 45036 |
| 51 | Ga0466718_155055 | 3300042617 | Bacteria | 1573 |
| 52 | Ga0466707_055582 | 3300042601 | Bacteria | 23414 |
| 53 | Ga0466713_096853 | 3300042602 | Bacteria | 66360 |
| 54 | Ga0466698_515374 | 3300042610 | Bacteria | 3213 |
| 55 | Ga0123357_10021680 | 3300009784 | Bacteria | 8599 |
| 56 | Ga0123357_10123013 | 3300009784 | Bacteria | 3260 |
| 57 | Ga0123354_10043689 | 3300010882 | Bacteria | 6885 |
| 58 | Ga0072941_1258624 | 3300005201 | Bacteria | 2749 |
| 59 | Ga0466735_005190 | 3300042624 | Bacteria | 49716 |
| 60 | Ga0466704_138839 | 3300042643 | Bacteria | 8832 |
| 61 | Ga0466704_180657 | 3300042643 | Bacteria | 2584 |
| 62 | Ga0466709_168350 | 3300042648 | Bacteria | 10736 |
| 63 | Ga0466708_103321 | 3300042652 | Bacteria | 11114 |
| 64 | Ga0466697_266679 | 3300042611 | Bacteria | 1469 |
| 65 | Ga0466705_085185 | 3300042612 | Bacteria | 2371 |
| 66 | Ga0466733_111296 | 3300042659 | Bacteria | 4837 |
| 67 | Ga0466715_157251 | 3300042616 | Bacteria | 7856 |
| 68 | Ga0466715_321742 | 3300042616 | Bacteria | 12207 |
| 69 | Ga0466715_594246 | 3300042616 | Bacteria | 6359 |
| 70 | Ga0466723_042363 | 3300042618 | Bacteria | 8065 |
| 71 | Ga0466723_254921 | 3300042618 | Bacteria | 25678 |
| 72 | Ga0466719_053619 | 3300042606 | Bacteria | 5502 |
| 73 | Ga0466722_237249 | 3300042609 | Bacteria | 156667 |
| 74 | Ga0123353_10230886 | 3300010167 | Bacteria | 2885 |
| 75 | Ga0466690_192319 | 3300042590 | Bacteria | 1613 |
| 76 | Ga0466692_169094 | 3300042591 | Bacteria | 7747 |
| 77 | Ga0466691_134428 | 3300042593 | Bacteria | 21583 |
| 78 | Ga0466703_253161 | 3300042636 | Bacteria | 9888 |
| 79 | Ga0466703_380786 | 3300042636 | Bacteria | 1455 |
| 80 | Ga0466709_002542 | 3300042648 | Bacteria | 17318 |
| 81 | Ga0466708_061843 | 3300042652 | Bacteria | 24472 |
| 82 | Ga0466705_107682 | 3300042612 | Bacteria | 6802 |
| 83 | Ga0466710_423667 | 3300042613 | Bacteria | 4445 |
| 84 | Ga0466723_320788 | 3300042618 | Unclassified | 2002 |
| 85 | Ga0466726_218359 | 3300042619 | Bacteria | 7027 |
| 86 | Ga0466726_268769 | 3300042619 | Bacteria | 31037 |
| 87 | Ga0466713_132377 | 3300042602 | Bacteria | 2129 |
| 88 | Ga0466722_029207 | 3300042609 | Bacteria | 33591 |
| 89 | Ga0264413_102656 | 3300024493 | Bacteria | 45196 |
| 90 | Ga0466694_030612 | 3300042594 | Bacteria | 4720 |
| 91 | 2227300225 | 2225789004 | Bacteria | 6616 |
| 92 | 2227336340 | 2225789004 | Bacteria | 6294 |
| 93 | JGI24695J34938_10005622 | 3300002450 | Bacteria | 7759 |
| 94 | Ga0466704_400292 | 3300042643 | Bacteria | 18203 |
| 95 | Ga0466708_258223 | 3300042652 | Bacteria | 25965 |
| 96 | Ga0466705_406904 | 3300042612 | Bacteria | 6629 |
| 97 | Ga0466715_018028 | 3300042616 | Bacteria | 16738 |
| 98 | Ga0466715_141679 | 3300042616 | Bacteria | 5348 |
| 99 | Ga0466718_114083 | 3300042617 | Bacteria | 2521 |
| 100 | Ga0466726_032888 | 3300042619 | Bacteria | 14302 |
| 101 | Ga0466706_214433 | 3300042599 | Bacteria | 4862 |
| 102 | Ga0466713_070766 | 3300042602 | Bacteria | 32826 |
| 103 | Ga0466690_360496 | 3300042590 | Bacteria | 6436 |
| 104 | Ga0466691_173677 | 3300042593 | Bacteria | 1406 |
| 105 | Ga0466695_373789 | 3300042595 | Bacteria | 3808 |
| 106 | Ga0466696_013234 | 3300042596 | Bacteria | 3737 |
| 107 | Ga0466696_130649 | 3300042596 | Bacteria | 3925 |
| 108 | Ga0466696_141791 | 3300042596 | Bacteria | 1990 |
| 109 | Ga0466701_013398 | 3300042598 | Bacteria | 2153 |
| 110 | JGI24705J35276_12238600 | 3300002504 | Bacteria | 28434 |
| 111 | Ga0123357_10001178 | 3300009784 | Bacteria | 27263 |
| 112 | Ga0466729_271502 | 3300042621 | Bacteria | 49123 |
| 113 | Ga0466703_423714 | 3300042636 | Bacteria | 1485 |
| 114 | Ga0466704_025752 | 3300042643 | Bacteria | 11044 |
| 115 | Ga0466705_075938 | 3300042612 | Bacteria | 39263 |
| 116 | Ga0466705_246449 | 3300042612 | Bacteria | 5383 |
| 117 | Ga0466715_144305 | 3300042616 | Bacteria | 4802 |
| 118 | Ga0466723_149182 | 3300042618 | Bacteria | 4478 |
| 119 | Ga0466714_010693 | 3300042603 | Bacteria | 2958 |
| 120 | Ga0466717_219760 | 3300042604 | Bacteria | 6086 |
| 121 | Ga0123353_10315123 | 3300010167 | Bacteria | 2378 |
| 122 | Ga0123353_10353162 | 3300010167 | Bacteria | 2214 |
| 123 | Ga0466703_094998 | 3300042636 | Bacteria | 5148 |
| 124 | Ga0466703_336976 | 3300042636 | Bacteria | 5462 |
| 125 | Ga0466704_038335 | 3300042643 | Bacteria | 5800 |
| 126 | Ga0466704_133697 | 3300042643 | Bacteria | 3183 |
| 127 | Ga0466708_287238 | 3300042652 | Bacteria | 17765 |
| 128 | Ga0466708_393856 | 3300042652 | Bacteria | 96483 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00850 | Hist_deacetyl | Histone deacetylase domain | 100 | 305 | 0.92 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.