Protein Family IF12208

Metagenome Isolate
171 Members
136 Samples
90 Scaffolds
192.64 Avg Length

🧬 Representative Sequence

ID
iso_pr_bacteria|2820911766|2820912849|
Length
228 aa
Sequence
MSPEKKAPAKAPAKAPAKAPAKAPAKGKAPAKDAPAKDAPPAEPTPKIPPRLKTRYKAEITPKLTEEFGYTNVHQVPGVTKIIVNMGVGEAAKDAKLMEGAVRDLTIITGQKPQITKAKRSVAQFKLREGMPIGCHVTLRGDRMWEFLDRLLTLALPRIRDFRGLSAQQFDGHGNYTFGLTEQSMFHEINPDTIDRQRGMDITVVTTAPNDEEGRALLKALGFPFKEN

📊 Sample Types

Isolate 47.4%
Metagenome 52.6%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Unclassified 23.7%
Termitidae 16.0%
Apidae 13.0%
Anthocoridae 7.6%
Kalotermitidae 6.1%
Tenebrionidae 5.3%
Scarabaeidae 4.6%
Cambaridae 4.6%
Formicidae 2.3%
Rhinotermitidae 2.3%
Armadillidiidae 2.3%
Termopsidae 2.3%
Dytiscidae 2.3%
Culicidae 1.5%
Elmidae 0.8%
Curculionidae 0.8%
Hydrophilidae 0.8%
Hodotermitidae 0.8%
Chironomidae 0.8%
Cerambycidae 0.8%
Pyralidae 0.8%
Pentatomidae 0.8%

🌳 Taxonomy

Archaea 0
Bacteria 167
Eukaryota 0
Viruses 0
Unclassified 4

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2820897376 Unclassified Actinobacteria Lab288P1bin101 Isolate Unclassified
2 2836973655 Gryllotalpicola protaetiae 2DFW10M-5 Isolate Scarabaeidae
3 2864899338 Mycobacteroides chelonae S00154 Isolate Elmidae
4 2894926108 Leucobacter sp. OLES1 Isolate Anthocoridae
5 2918390780 Glutamicibacter protophormiae DSM 20168 Isolate Unclassified
6 2684622918 Bifidobacterium asteroides Bi_198 Isolate Unclassified
7 3300056790 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) Metagenome Tenebrionidae
8 3300056856 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) Metagenome Tenebrionidae
9 8024981139 Bifidobacterium asteroides ESL0170 Isolate Apidae
10 8024984606 Bifidobacterium asteroides ESL0199 Isolate Apidae
11 8069511479 Arthrobacter ipsi IA7 Isolate Curculionidae
12 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
13 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
14 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
15 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
16 2873589062 Phycicoccus sp. HDW14 Isolate Hydrophilidae
17 2915157839 Leucobacter sp. cx-42 Isolate Cambaridae
18 3300007190 Ant gut microbial communities from Cephalotes umbraculatus, Peru Metagenome Formicidae
19 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
20 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
21 2504756063 Isoptericola variabilis J5 Isolate Unclassified
22 2597490194 Bifidobacterium coryneforme LMG 18911 Isolate Apidae
23 2671180601 Bifidobacterium asteroides DSM 20089 Isolate Unclassified
24 2734481968 Xylanimicrobium pachnodae JCM 13526, NBRC 107786 Isolate Scarabaeidae
25 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
26 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
27 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
28 3300056564 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS_oats (Improved Draft) Metagenome Tenebrionidae
29 3300056814 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE (version 2) Metagenome Tenebrionidae
30 3300056857 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS (version 2) Metagenome Tenebrionidae
31 3300057007 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP_oats (version 2) Metagenome Tenebrionidae
32 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
33 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
34 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
35 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
36 8110341875 Bifidobacterium polysaccharolyticum W8117 Isolate Apidae
37 2863397684 Micromonospora polyrhachis DSM 45886 (Annotation) (version 2) Isolate Unclassified
38 2894981435 Leucobacter sp. OLDS2 Isolate Anthocoridae
39 2931425734 Nocardioides sp. J2M5 Isolate
40 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
41 3300012824 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E11 MG Metagenome Armadillidiidae
42 3300012849 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG Metagenome Culicidae
43 3300012850 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E0 MG Metagenome Culicidae
44 2772190761 Rhodococcus rhodnii NRRL B-16535 Isolate Unclassified
45 2808606957 Bifidobacterium sp. ESL0447 Isolate Unclassified
46 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
47 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
48 2820807258 Unclassified Actinobacteria Nt197P3bin90 Isolate Unclassified
49 2820889385 Unclassified Actinobacteria Lab288P1bin133 Isolate Unclassified
50 2820922474 Unclassified Actinobacteria Emb289P3bin154 Isolate Unclassified
51 2820926697 Unclassified Actinobacteria Emb289P3bin125 Isolate Unclassified
52 2824199081 Bifidobacterium commune DSM 28792 Isolate Unclassified
53 2837204985 Lysinimonas sp. 2DFWR-13 Isolate Scarabaeidae
54 2865982043 Bifidobacterium aemilianum XV10 Isolate Apidae
55 2894944011 Leucobacter sp. OLAS13 Isolate Anthocoridae
56 2915166107 Leucobacter sp. cx-87 Isolate Cambaridae
57 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
58 3300012834 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E6 MG Metagenome
59 2505679068 Isoptericola variabilis 225 Isolate Unclassified
60 2513237174 Bifidobacterium asteroides ATCC 25910 Isolate Apidae
61 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
62 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
63 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
64 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
65 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
66 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
67 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
68 8110340172 Bifidobacterium choladohabitans B14384H11 Isolate Apidae
69 2894932631 Leucobacter sp. OAMLP11 Isolate Anthocoridae
70 2894966443 Leucobacter sp. OLCALW19 Isolate Anthocoridae
71 2910090113 Kocuria sp. cx-116 Isolate Cambaridae
72 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
73 2515154100 Streptomyces sp. MspMP-M5 Isolate Unclassified
74 2519899775 Bifidobacterium asteroides PRL2011 Isolate Apidae
75 2524023214 Leucobacter chironomi DSM 19883 Isolate Chironomidae
76 2597490239 Bifidobacterium bohemicum DSM 22767 Isolate Unclassified
77 2663763384 Bifidobacterium bombi DSM 19703 Isolate Apidae
78 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
79 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
80 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
81 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
82 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
83 2820863028 Unclassified Actinobacteria Lab288P3bin164 Isolate Unclassified
84 2852016966 Micromonospora polyrhachis DSM 45886 Isolate Unclassified
85 2873617540 Leucobacter insecticola HDW9B Isolate Dytiscidae
86 2883683260 Protaetiibacter larvae KACC 19322 Isolate Scarabaeidae
87 2894900265 Leucobacter sp. OLTLW20 Isolate Anthocoridae
88 2894929448 Leucobacter sp. OAMSW11 Isolate Anthocoridae
89 2915168811 Leucobacter sp. cx-169 Isolate Cambaridae
90 3300002501 Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 Metagenome Termitidae
91 3300007129 Ant gut microbial communities from Cephalotes atratus, Brazil Metagenome Formicidae
92 3300012815 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E1 MG Metagenome
93 2568526170 Bifidobacterium sp. A11 Isolate Apidae
94 2600255079 Bifidobacterium bombi DSM 19703 Isolate Apidae
95 2684622919 Bifidobacterium asteroides Bi_199 Isolate Unclassified
96 2731957681 Xylanimicrobium pachnodae JCM 13526, NBRC 107786 Isolate Scarabaeidae
97 2818991320 Klugiella xanthotipulae DSM 18031 Isolate Unclassified
98 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
99 8024986378 Bifidobacterium asteroides ESL0198 Isolate Apidae
100 8032009961 Bifidobacterium indicum ESL0197 Isolate Apidae
101 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
102 2820825283 Unclassified Actinobacteria Nt197P3bin111 Isolate Unclassified
103 2820911766 Unclassified Actinobacteria Emb289P3bin96 Isolate Unclassified
104 2873620646 Leucobacter coleopterorum HDW9A Isolate Dytiscidae
105 2883361506 Luteimicrobium xylanilyticum HY-24 Isolate Cerambycidae
106 2894935787 Leucobacter sp. OLJS4 Isolate Anthocoridae
107 2909881144 Kocuria sp. cx-455 Isolate Cambaridae
108 2915160415 Leucobacter sp. cx-328 Isolate Cambaridae
109 3300005721 Honey bee gut microbiome from Carl Hayden Bee Research Center, Tucson, Arizona, USA - sample 1, colony 176 Metagenome Apidae
110 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
111 3300012825 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E1 MG Metagenome
112 3300012848 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG Metagenome Armadillidiidae
113 2660238275 Bifidobacterium indicum DSM 20214 Isolate Unclassified
114 2684622916 Bifidobacterium asteroides Bi_170 Isolate Unclassified
115 2684622917 Bifidobacterium coryneforme Bi_197 Isolate Unclassified
116 2693429521 Bifidobacterium coryneforme DSM 20216 Isolate Unclassified
117 2788500098 Bombiscardovia coagulans DSM 22924 Isolate Apidae
118 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
119 3300056842 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) Metagenome Tenebrionidae
120 8012935351 Brevibacterium epidermidis UD i117 Isolate Unclassified
121 8024982947 Bifidobacterium asteroides ESL0200 Isolate Apidae
122 8067071256 Microbispora camponoti 2C-HV3 Isolate Formicidae
123 2841168549 Agromyces protaetiae FW100M-8 Isolate Scarabaeidae
124 2873614151 Leucobacter viscericola HDW9C Isolate Dytiscidae
125 2879643867 Bifidobacterium sp. wkB344 Isolate Apidae
126 2884351759 Cellulosimicrobium sp. BI34T Isolate Pyralidae
127 2894897082 Leucobacter sp. OLCS4 Isolate Anthocoridae
128 2894974975 Leucobacter sp. OLIS6 Isolate Anthocoridae
129 2912749649 Streptomyces sp. GS7 Isolate Termitidae
130 3006461590 Streptomyces sp. RB5 Isolate Termitidae
131 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
132 3300012806 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E1 MG Metagenome
133 3300012858 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG Metagenome Armadillidiidae
134 2684622920 Bifidobacterium asteroides Bi_200 Isolate Unclassified
135 2802429577 Bifidobacterium indicum DSM 20214 Isolate Unclassified
136 2818991478 Micromonospora palomenae DSM 102131 Isolate Pentatomidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0562378_0727 3300056814 Bacteria 47065
2 Ga0562375_0569 3300056856 Bacteria 72979
3 Ga0562375_1322 3300056856 Bacteria 34684
4 Ga0466723_266327 3300042618 Bacteria 9665
5 Ga0466724_27243 3300042649 Bacteria 6777
6 Ga0466725_157377 3300042654 Bacteria 1172
7 Ga0466727_310943 3300042655 Bacteria 2727
8 Ga0466701_080217 3300042598 Bacteria 1740
9 Ga0466714_084576 3300042603 Bacteria 3015
10 Ga0123355_10643851 3300009826 Bacteria 1240
11 Ga0123356_10000385 3300010049 Bacteria 50352
12 Ga0160452_100013 3300012834 Bacteria 343612
13 Ga0160447_119197 3300012849 Bacteria 1140
14 Ga0160457_1002026 3300012858 Bacteria 4717
15 Ga0466718_016351 3300042617 Bacteria 1635
16 Ga0466702_414565 3300042635 Bacteria 1755
17 Ga0466707_017254 3300042601 Bacteria 1129
18 Ga0466707_351878 3300042601 Bacteria 23367
19 Ga0123353_10073386 3300010167 Bacteria 5499
20 Ga0074278_142794 3300005721 Bacteria 8443
21 Ga0160441_108399 3300012825 Bacteria 1341
22 Ga0160443_100074 3300012848 Bacteria 181634
23 Ga0466705_381491 3300042612 Bacteria 1291
24 Ga0562377_0007 3300056842 Bacteria 3019242
25 Ga0562374_0059 3300057007 Bacteria 399716
26 Ga0466705_489772 3300042612 Bacteria 2705
27 Ga0466710_143511 3300042613 Bacteria 1252
28 Ga0466723_192402 3300042618 Bacteria 3308
29 Ga0466730_021677 3300042625 Bacteria 1171
30 Ga0466727_342211 3300042655 Bacteria 1574
31 Ga0466697_037123 3300042611 Bacteria 2951
32 Ga0123353_10000701 3300010167 Bacteria 40961
33 AustNasuHG_c1000417 3300000089 Bacteria 14762
34 Ga0466692_162196 3300042591 Bacteria 2717
35 Ga0466693_352601 3300042592 Bacteria 5048
36 Ga0562379_4734 3300056790 Bacteria 6255
37 Ga0466711_051634 3300042615 Bacteria 4203
38 Ga0466734_165799 3300042623 Bacteria 1539
39 Ga0466730_004617 3300042625 Bacteria 1882
40 Ga0466703_144605 3300042636 Bacteria 9715
41 Ga0466703_189329 3300042636 Bacteria 1762
42 Ga0466724_66581 3300042649 Bacteria 665985
43 Ga0466707_323418 3300042601 Unclassified 2576
44 Ga0466713_021277 3300042602 Bacteria 1439
45 Ga0466713_101616 3300042602 Bacteria 503322
46 Ga0466722_114635 3300042609 Bacteria 2297
47 JGI24703J35330_11745970 3300002501 Bacteria 4893
48 Ga0160440_100031 3300012815 Bacteria 222224
49 Ga0160434_100001 3300012850 Bacteria 617314
50 Ga0160434_110663 3300012850 Unclassified 1490
51 Ga0466657_291877 3300042582 Bacteria 2136
52 Ga0466705_169911 3300042612 Unclassified 3305
53 Ga0466705_237471 3300042612 Bacteria 13038
54 Ga0466705_285411 3300042612 Bacteria 2555
55 Ga0562378_0076 3300056814 Bacteria 275011
56 Ga0466734_107278 3300042623 Bacteria 1989
57 Ga0466724_02272 3300042649 Bacteria 4055
58 Ga0466708_172769 3300042652 Bacteria 7449
59 Ga0103267_1105990 3300007190 Bacteria 761
60 Ga0160469_100487 3300012824 Bacteria 17913
61 Ga0562375_0080 3300056856 Bacteria 309561
62 Ga0466723_373595 3300042618 Bacteria 7057
63 Ga0466726_443180 3300042619 Bacteria 2037
64 Ga0466729_108585 3300042621 Bacteria 3906
65 Ga0466729_208868 3300042621 Bacteria 4517
66 Ga0466704_198981 3300042643 Bacteria 5425
67 Ga0466708_205008 3300042652 Bacteria 28180
68 Ga0466706_047001 3300042599 Bacteria 29829
69 Ga0466714_135898 3300042603 Bacteria 7216
70 Ga0123357_10003869 3300009784 Bacteria 17362
71 Ga0123356_10004286 3300010049 Bacteria 14755
72 Ga0123353_10979098 3300010167 Bacteria 1140
73 Ga0068302_10032516 3300005071 Bacteria 3928
74 Ga0530661_017760 3300056564 Bacteria 2007
75 Ga0562378_0012 3300056814 Bacteria 1041899
76 Ga0466710_311777 3300042613 Bacteria 6061
77 Ga0466715_502498 3300042616 Bacteria 2293
78 Ga0160442_100131 3300012806 Unclassified 75763
79 JGI24698J34947_10070994 3300002449 Bacteria 1673
80 Ga0466705_293325 3300042612 Bacteria 2154
81 Ga0466705_317176 3300042612 Bacteria 1212
82 Ga0466705_364443 3300042612 Bacteria 2721
83 Ga0562376_3020 3300056857 Bacteria 18242
84 Ga0466723_157225 3300042618 Bacteria 18330
85 Ga0466723_289451 3300042618 Bacteria 49429
86 Ga0466703_133753 3300042636 Bacteria 110740
87 Ga0123356_10000101 3300010049 Bacteria 90121
88 Ga0123353_11184574 3300010167 Bacteria 1004
89 Ga0102734_1020722 3300007129 Bacteria 1637
90 Ga0466696_309050 3300042596 Bacteria 5136

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00281 Ribosomal_L5 Ribosomal protein L5 72 128 0.99
PF00673 Ribosomal_L5_C ribosomal L5P family C-terminus 132 225 0.99

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.