Protein Family IF12174

Metagenome Isolate
115 Members
59 Samples
97 Scaffolds
262.7 Avg Length

🧬 Representative Sequence

ID
iso_pr_bacteria|2820823448|2820824834|
Length
299 aa
Sequence
MSIEISNLDFSYGTKQVLRNLNLSINPAETLTILGPNGSGKTTFLSLVAGLLAPSGGSIVYDGKPFKAMSLRKMAQLVGYVPQILMPAFDYSVLDYVVTGCAPQIGSLGRPRQKHYDTALEAIQLLGIEHLTEKSYRQISGGERQQVSIARVLAQSPTYILMDEPTSHLDYGNQIRVLKTIKQLKEKGFGVVFTTHNPDQALLIEGKTAIIDRQGNLVFGDSSEMIDEEYLSELFGTQMRIARIEKKGRKVCYAASLNNEETEEAERVEEAELAEEAEMAEEAERVEEVELVEEMGADI

📊 Sample Types

Isolate 15.7%
Metagenome 84.3%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 36.2%
Unclassified 34.5%
Kalotermitidae 17.2%
Rhinotermitidae 5.2%
Termopsidae 3.4%
Hodotermitidae 1.7%
Tenebrionidae 1.7%

🌳 Taxonomy

Archaea 17
Bacteria 85
Eukaryota 0
Viruses 0
Unclassified 13

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2820238527 Unclassified Firmicutes Th196P3bin90 Isolate Unclassified
2 2820422691 Unclassified Firmicutes Lab288P3bin58 Isolate Unclassified
3 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
4 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
5 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
6 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
7 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
8 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
9 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
10 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
11 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
12 2772190976 Unclassified Bathyarchaeota Co191P4bin18 Isolate Unclassified
13 2772190993 Unclassified Euryarchaeota Lab288P4bin101 Isolate Unclassified
14 2820227065 Unclassified Firmicutes Th196P4bin44 Isolate Unclassified
15 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
16 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
17 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
18 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
19 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
20 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
21 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
22 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
23 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
24 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
25 2820353569 Unclassified Firmicutes Nt197P3bin28 Isolate Unclassified
26 2684622743 Methanobrevibacter cuticularis DSM11139 Isolate Unclassified
27 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
28 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
29 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
30 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
31 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
32 2820451402 Unclassified Firmicutes Lab288P3bin174 Isolate Unclassified
33 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
34 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
35 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
36 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
37 2773857693 Methanobrevibacter sp. Th196P3bin91 Isolate Unclassified
38 2772190988 Unclassified Bathyarchaeota Co191P1bin46 Isolate Unclassified
39 2684622740 Methanobrevibacter filiformis DSM11501 Isolate Unclassified
40 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
41 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
42 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
43 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
44 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
45 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
46 2820856540 Unclassified Actinobacteria Lab288P3bin21 Isolate Unclassified
47 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
48 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
49 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
50 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
51 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
52 2820823448 Unclassified Actinobacteria Nt197P3bin113 Isolate Unclassified
53 2820414148 Unclassified Firmicutes Lab288P3bin93 Isolate Unclassified
54 2820729191 Unclassified Chloroflexi Th196P4bin49 Isolate Unclassified
55 2772190974 Unclassified Bathyarchaeota Co191P3bin4 Isolate Unclassified
56 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
57 3300056842 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) Metagenome Tenebrionidae
58 2989309576 Sporomusa termitida DSM 4440 Isolate Unclassified
59 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466693_055288 3300042592 Bacteria 4524
2 Ga0466694_091519 3300042594 Bacteria 1373
3 Ga0466715_455053 3300042616 Bacteria 1561
4 Ga0466733_208920 3300042659 Bacteria 9298
5 Ga0466707_095380 3300042601 Bacteria 19035
6 Ga0466707_386102 3300042601 Bacteria 5509
7 Ga0466713_050374 3300042602 Archaea 1928
8 Ga0466713_095932 3300042602 Bacteria 1820
9 Ga0466717_120099 3300042604 Bacteria 3345
10 Ga0466720_097565 3300042607 Bacteria 5614
11 Ga0466692_111300 3300042591 Bacteria 13065
12 Ga0466693_094003 3300042592 Unclassified 22536
13 Ga0123356_10093408 3300010049 Bacteria 2871
14 Ga0123356_10096983 3300010049 Unclassified 2820
15 Ga0123353_10151347 3300010167 Bacteria 3704
16 Ga0123353_10431809 3300010167 Bacteria 1947
17 Ga0123353_10855701 3300010167 Archaea 1245
18 Ga0123354_10037858 3300010882 Archaea 7501
19 Ga0466709_094434 3300042648 Bacteria 7631
20 Ga0466705_442828 3300042612 Bacteria 6310
21 Ga0466707_118439 3300042601 Bacteria 1665
22 Ga0466707_347455 3300042601 Bacteria 2025
23 JGI24702J35022_10013308 3300002462 Bacteria 4558
24 JGI24702J35022_10027046 3300002462 Unclassified 3086
25 JGI24702J35022_10052050 3300002462 Bacteria 2182
26 Ga0123356_10021839 3300010049 Bacteria 6043
27 Ga0123356_10092192 3300010049 Bacteria 2889
28 Ga0123356_10380571 3300010049 Bacteria 1544
29 Ga0123353_10158825 3300010167 Bacteria 3601
30 Ga0123353_10531334 3300010167 Bacteria 1703
31 Ga0123353_10743114 3300010167 Bacteria 1367
32 Ga0466718_016217 3300042617 Bacteria 5420
33 Ga0466723_229059 3300042618 Bacteria 3718
34 JGI24705J35276_12210405 3300002504 Unclassified 1825
35 Ga0072940_1019944 3300005200 Bacteria 2539
36 Ga0072941_1539388 3300005201 Bacteria 2173
37 Ga0466657_390862 3300042582 Bacteria 1245
38 Ga0466694_133277 3300042594 Bacteria 3922
39 Ga0123355_10021098 3300009826 Bacteria 10422
40 Ga0123356_10018386 3300010049 Archaea 6638
41 Ga0123356_10047969 3300010049 Bacteria 3974
42 Ga0123356_10064595 3300010049 Bacteria 3422
43 Ga0123353_10044553 3300010167 Unclassified 7034
44 Ga0123353_10102501 3300010167 Bacteria 4613
45 Ga0123354_10383713 3300010882 Bacteria 1209
46 Ga0466731_198448 3300042622 Bacteria 1032
47 Ga0466727_237098 3300042655 Bacteria 54922
48 Ga0466715_546726 3300042616 Bacteria 26201
49 Ga0466729_110919 3300042621 Bacteria 1544
50 Ga0466729_126383 3300042621 Bacteria 1352
51 Ga0466732_201163 3300042656 Bacteria 2281
52 Ga0466706_249928 3300042599 Archaea 6018
53 Ga0466719_117396 3300042606 Bacteria 21757
54 Ga0466722_150294 3300042609 Bacteria 5241
55 JGI24702J35022_10005291 3300002462 Archaea 7566
56 JGI24702J35022_10005836 3300002462 Unclassified 7161
57 Ga0466694_067501 3300042594 Bacteria 3253
58 Ga0466699_091287 3300042597 Bacteria 1222
59 Ga0123356_10001339 3300010049 Bacteria 27238
60 Ga0123356_10483496 3300010049 Bacteria 1392
61 Ga0123353_10351747 3300010167 Bacteria 2219
62 Ga0123353_10400151 3300010167 Bacteria 2044
63 Ga0466704_438826 3300042643 Bacteria 4134
64 Ga0466727_048034 3300042655 Archaea 15742
65 Ga0466700_333507 3300042600 Bacteria 3299
66 Ga0466719_353773 3300042606 Bacteria 2232
67 JGI24702J35022_10099911 3300002462 Bacteria 1587
68 Ga0466691_109100 3300042593 Bacteria 46214
69 Ga0466699_132261 3300042597 Bacteria 1711
70 Ga0123355_10599406 3300009826 Bacteria 1308
71 Ga0123356_10692670 3300010049 Bacteria 1188
72 Ga0123353_10021497 3300010167 Unclassified 9688
73 Ga0123353_10377019 3300010167 Bacteria 2124
74 Ga0466731_234367 3300042622 Bacteria 3846
75 Ga0466734_085743 3300042623 Bacteria 16721
76 Ga0466711_030379 3300042615 Bacteria 5434
77 Ga0466697_141119 3300042611 Bacteria 3990
78 Ga0466697_195780 3300042611 Bacteria 2362
79 Ga0466705_116323 3300042612 Bacteria 13062
80 Ga0466716_052421 3300042605 Archaea 17196
81 Ga0466722_151733 3300042609 Unclassified 5328
82 JGI24702J35022_10007822 3300002462 Unclassified 6093
83 Ga0068305_10049078 3300005083 Unclassified 5494
84 Ga0466694_174941 3300042594 Archaea 3158
85 Ga0466696_410906 3300042596 Bacteria 1045
86 Ga0123355_10079863 3300009826 Bacteria 5223
87 Ga0123353_10054999 3300010167 Bacteria 6365
88 Ga0466711_385707 3300042615 Archaea 3134
89 Ga0466726_024904 3300042619 Unclassified 14347
90 Ga0562377_0006 3300056842 Bacteria 3350072
91 JGI24695J34938_10003001 3300002450 Unclassified 12137
92 JGI24702J35022_10056339 3300002462 Unclassified 2097
93 Ga0466691_041967 3300042593 Bacteria 27590
94 Ga0123356_10041679 3300010049 Bacteria 4278
95 Ga0123353_10141320 3300010167 Bacteria 3856
96 Ga0466704_279922 3300042643 Bacteria 4104
97 Ga0466711_260290 3300042615 Bacteria 1855

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00005 ABC_tran ABC transporter 18 167 0.92
PF13304 AAA_21 AAA domain, putative AbiEii toxin, Type IV TA system 154 198 0.87

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.