Protein Family IF12124

Metagenome Isolate
134 Members
35 Samples
121 Scaffolds
259.54 Avg Length

🧬 Representative Sequence

ID
iso_pr_bacteria|2820637417|2820638725|
Length
311 aa
Sequence
MVTDTENLNKEMTPTEKKAEERRAREKRVKELRERKAREKAAQEKQKQESAGKEKTPYELVRGARSKNRLTSLDFIKGLFRGFIELHGDRRFADDPAVIAGVAYLGDTPFTVIGTEKGRDTKSRIKHNFGTPNPEGYRKSLRLMKQAEKFKRPVICFVDTSGAFCGIGAEERGQGQAIAENIMELMTLKTPVLSILIGEGGSGGALALAVADEVWMFENAVYSVISPEGCANILWREPEKADEAAQNLKLTSKNISDLGVVDRVIPEKSRDPEKMLHDLSAQIIEWYKNTSEIPVDELTQRRYERFRKLGV

📊 Sample Types

Isolate 9.7%
Metagenome 90.3%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 48.6%
Unclassified 37.1%
Kalotermitidae 8.6%
Rhinotermitidae 2.9%
Passalidae 2.9%

🌳 Taxonomy

Archaea 0
Bacteria 122
Eukaryota 0
Viruses 0
Unclassified 12

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2820364642 Unclassified Firmicutes Nt197P3bin107 Isolate Unclassified
2 2820836992 Unclassified Actinobacteria Lab288P4bin32 Isolate Unclassified
3 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
4 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
5 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
6 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
7 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
8 2820620956 Unclassified Firmicutes Emb289P1bin128 Isolate Unclassified
9 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
10 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
11 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
12 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
13 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
14 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
15 2820442516 Unclassified Firmicutes Lab288P3bin200 Isolate Unclassified
16 2820594669 Unclassified Firmicutes Emb289P1bin61 Isolate Unclassified
17 2820606014 Unclassified Firmicutes Emb289P1bin49 Isolate Unclassified
18 2820683647 Unclassified Firmicutes Co191P1bin82 Isolate Unclassified
19 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
20 2820318056 Unclassified Firmicutes Nt197P3bin94 Isolate Unclassified
21 2820566695 Unclassified Firmicutes Emb289P3bin50 Isolate Unclassified
22 2820666966 Unclassified Firmicutes Co191P3bin39 Isolate Unclassified
23 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
24 2820231849 Unclassified Firmicutes Th196P4bin1 Isolate Unclassified
25 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
26 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
27 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
28 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
29 2820637417 Unclassified Firmicutes Emb289P1bin108 Isolate Unclassified
30 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
31 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
32 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
33 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
34 2820282995 Unclassified Firmicutes Th196P3bin147 Isolate Unclassified
35 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 JGI24702J35022_10002660 3300002462 Bacteria 10844
2 Ga0466725_001081 3300042654 Bacteria 1276
3 Ga0466725_087630 3300042654 Bacteria 1649
4 Ga0415639_079715 3300038395 Bacteria 2034
5 Ga0466694_205679 3300042594 Bacteria 10451
6 Ga0123355_10031586 3300009826 Bacteria 8591
7 Ga0123356_10000606 3300010049 Bacteria 39577
8 Ga0123356_10011041 3300010049 Bacteria 8820
9 Ga0123356_10013023 3300010049 Bacteria 8046
10 Ga0123356_10013993 3300010049 Bacteria 7720
11 Ga0123356_10099247 3300010049 Unclassified 2790
12 Ga0123356_10132676 3300010049 Bacteria 2443
13 Ga0123356_10481767 3300010049 Unclassified 1394
14 Ga0123356_10700866 3300010049 Bacteria 1182
15 Ga0123356_10929764 3300010049 Bacteria 1041
16 Ga0123353_10084345 3300010167 Bacteria 5114
17 Ga0123353_10268161 3300010167 Bacteria 2632
18 Ga0123353_10466392 3300010167 Bacteria 1853
19 Ga0123354_10031845 3300010882 Bacteria 8271
20 Ga0123354_10283837 3300010882 Bacteria 1602
21 IMNBL1DRAFT_c0003136 3300000062 Bacteria 10876
22 JGI24695J34938_10000068 3300002450 Bacteria 86379
23 Ga0123355_10108314 3300009826 Bacteria 4350
24 Ga0123356_10000010 3300010049 Bacteria 220063
25 Ga0123356_10297139 3300010049 Unclassified 1718
26 Ga0123356_10305155 3300010049 Bacteria 1699
27 Ga0123356_10789487 3300010049 Bacteria 1120
28 Ga0123356_11013855 3300010049 Bacteria 1000
29 Ga0123353_10798771 3300010167 Unclassified 1303
30 Ga0123354_10109394 3300010882 Unclassified 3662
31 Ga0123354_10240878 3300010882 Unclassified 1861
32 Ga0123354_10325030 3300010882 Bacteria 1412
33 Ga0466717_266815 3300042604 Unclassified 1779
34 Ga0466721_119321 3300042608 Bacteria 9241
35 Ga0123355_10000002 3300009826 Bacteria 241009
36 Ga0123356_10063395 3300010049 Bacteria 3453
37 Ga0123356_10070406 3300010049 Bacteria 3281
38 Ga0123356_10236507 3300010049 Bacteria 1895
39 Ga0123356_10300854 3300010049 Unclassified 1709
40 Ga0123356_10391004 3300010049 Bacteria 1526
41 Ga0123356_10786785 3300010049 Bacteria 1122
42 Ga0123353_10247863 3300010167 Bacteria 2762
43 Ga0123353_10262987 3300010167 Bacteria 2663
44 Ga0123353_11188040 3300010167 Bacteria 1002
45 Ga0123354_10342753 3300010882 Bacteria 1344
46 JGI24702J35022_10089141 3300002462 Bacteria 1677
47 JGI24702J35022_10175987 3300002462 Bacteria 1213
48 Ga0123355_10000836 3300009826 Bacteria 42314
49 Ga0123356_10002104 3300010049 Bacteria 21470
50 Ga0123356_10025865 3300010049 Bacteria 5518
51 Ga0123356_10046611 3300010049 Bacteria 4033
52 Ga0123356_10071978 3300010049 Bacteria 3246
53 Ga0123356_10138603 3300010049 Bacteria 2396
54 Ga0123356_10171668 3300010049 Bacteria 2180
55 Ga0123356_10578567 3300010049 Bacteria 1286
56 Ga0123356_10807528 3300010049 Bacteria 1109
57 Ga0123356_10816137 3300010049 Bacteria 1104
58 Ga0123353_10169588 3300010167 Bacteria 3466
59 Ga0123353_10396091 3300010167 Bacteria 2057
60 Ga0123353_10674745 3300010167 Unclassified 1457
61 Ga0466701_059273 3300042598 Bacteria 1177
62 Ga0466719_507794 3300042606 Bacteria 1750
63 Ga0466693_447480 3300042592 Bacteria 1170
64 Ga0123357_10138417 3300009784 Bacteria 3001
65 Ga0123355_10275064 3300009826 Bacteria 2333
66 Ga0123356_10004158 3300010049 Bacteria 15022
67 Ga0123356_10014915 3300010049 Bacteria 7459
68 Ga0123356_10017549 3300010049 Bacteria 6809
69 Ga0466714_132945 3300042603 Bacteria 2713
70 Ga0466714_133555 3300042603 Bacteria 5069
71 Ga0466725_241173 3300042654 Bacteria 8912
72 Ga0415639_242905 3300038395 Bacteria 1134
73 Ga0466694_171113 3300042594 Bacteria 1942
74 Ga0123355_10014126 3300009826 Bacteria 12462
75 Ga0123355_10022239 3300009826 Bacteria 10165
76 Ga0123356_10055662 3300010049 Bacteria 3685
77 Ga0123356_10077123 3300010049 Bacteria 3142
78 Ga0123356_10077938 3300010049 Unclassified 3127
79 Ga0123356_10114471 3300010049 Bacteria 2612
80 Ga0123356_10153542 3300010049 Bacteria 2289
81 Ga0123353_10000593 3300010167 Bacteria 44284
82 Ga0123353_10241909 3300010167 Bacteria 2803
83 Ga0123353_10601758 3300010167 Bacteria 1571
84 Ga0123353_10719060 3300010167 Bacteria 1397
85 Ga0123353_10923527 3300010167 Bacteria 1185
86 Ga0466700_273598 3300042600 Bacteria 3718
87 Ga0466721_112885 3300042608 Bacteria 1721
88 Ga0466722_067669 3300042609 Bacteria 2254
89 JGI24705J35276_12217769 3300002504 Bacteria 2110
90 JGI24705J35276_12235784 3300002504 Bacteria 6979
91 Ga0466690_012722 3300042590 Bacteria 2387
92 Ga0466693_446689 3300042592 Bacteria 12598
93 Ga0466696_407583 3300042596 Bacteria 1621
94 Ga0123355_10027263 3300009826 Unclassified 9225
95 Ga0123356_10082822 3300010049 Bacteria 3038
96 Ga0123356_10211548 3300010049 Bacteria 1988
97 Ga0123356_11355101 3300010049 Bacteria 873
98 Ga0123353_10011129 3300010167 Bacteria 12648
99 Ga0123353_10220034 3300010167 Bacteria 2970
100 Ga0123353_10246788 3300010167 Bacteria 2769
101 Ga0123353_10261831 3300010167 Bacteria 2670
102 Ga0123353_10354663 3300010167 Bacteria 2208
103 Ga0123353_10909454 3300010167 Bacteria 1197
104 Ga0466717_019389 3300042604 Bacteria 2864
105 JGI24702J35022_10004470 3300002462 Bacteria 8300
106 Ga0415639_219643 3300038395 Bacteria 1149
107 Ga0123355_10002364 3300009826 Bacteria 26665
108 Ga0123355_10008392 3300009826 Bacteria 15612
109 Ga0123356_10019709 3300010049 Bacteria 6393
110 Ga0123356_10099851 3300010049 Bacteria 2783
111 Ga0123356_10112717 3300010049 Bacteria 2630
112 Ga0123356_10217462 3300010049 Bacteria 1965
113 Ga0123356_10383947 3300010049 Bacteria 1538
114 Ga0123356_10435662 3300010049 Bacteria 1456
115 Ga0123356_10491653 3300010049 Bacteria 1381
116 Ga0123356_10521766 3300010049 Bacteria 1346
117 Ga0123353_10221130 3300010167 Bacteria 2961
118 Ga0123353_10286210 3300010167 Bacteria 2527
119 Ga0123353_10534298 3300010167 Bacteria 1697
120 Ga0123353_10737236 3300010167 Unclassified 1374
121 Ga0466721_349881 3300042608 Bacteria 1441

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF03255 ACCA Acetyl co-enzyme A carboxylase carboxyltransferase-like 9 310 0.92
PF01039 Carboxyl_trans Carboxyl transferase domain 97 249 0.86

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.