Protein Family IF12110

Metagenome Isolate
147 Members
83 Samples
86 Scaffolds
300.18 Avg Length

🧬 Representative Sequence

ID
iso_pr_bacteria|2820581541|2820582493|
Length
345 aa
Sequence
MTVFDEIAPLLSDFLTDEPMKNHTSFRIGGAADILAMPKTSDELIKIFKFCEEKNFPLTILGDGANVLVSDEGIRGVVVFTNKMKEISVRENKIFASAGARLSALAEAACVAGLAGLEFASGIPGTVGGAIFMNAGAFGFDISNFCEHVTLFYENKIVKKSNAEMEFAYRKSFVQRIAHEKIACAKKNSCEEKKLCEENSREENSCEEKKFREENSCVQKNSSSLCEILILDATFSLLRGEPELIREKMRELNGKRKNSQPLEFHSAGSFFKRPEGHYAGKLIEVCGLKGFSVGDAQVSEKHAGFVINRGNATAKNILELMHHVQKTVYEKFGVHLEPEVQMLGF

📊 Sample Types

Isolate 41.5%
Metagenome 58.5%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Unclassified 59.0%
Apidae 18.1%
Termitidae 14.5%
Kalotermitidae 3.6%
Termopsidae 2.4%
Hodotermitidae 1.2%
Rhinotermitidae 1.2%

🌳 Taxonomy

Archaea 0
Bacteria 144
Eukaryota 0
Viruses 0
Unclassified 3

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 8004832522 Lactobacillus sp. ESL0236 Isolate Apidae
2 2758568501 Lactobacillus bombicola ESL0228 Isolate Unclassified
3 2758568502 Lactobacillus bombicola ESL0247 Isolate Unclassified
4 2758568503 Lactobacillus bombicola ESL0246 Isolate Unclassified
5 2758568511 Lactobacillus apis ESL0263 Isolate Unclassified
6 2820254385 Unclassified Firmicutes Th196P3bin54 Isolate Unclassified
7 2820285501 Unclassified Firmicutes Th196P3bin142 Isolate Unclassified
8 2820546020 Unclassified Firmicutes Lab288P1bin102 Isolate Unclassified
9 2820620956 Unclassified Firmicutes Emb289P1bin128 Isolate Unclassified
10 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
11 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
12 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
13 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
14 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
15 2758568504 Lactobacillus bombicola ESL0245 Isolate Unclassified
16 2820378768 Unclassified Firmicutes Nt197P1bin7 Isolate Unclassified
17 2820382897 Unclassified Firmicutes Nt197P1bin3 Isolate Unclassified
18 2820513949 Unclassified Firmicutes Lab288P1bin39 Isolate Unclassified
19 2820693137 Unclassified Firmicutes Co191P1bin70 Isolate Unclassified
20 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
21 2877513988 Lactobacillus kullabergensis ESL0186 Isolate Apidae
22 8017440191 Lactobacillus bombicola L5-31 Isolate Apidae
23 2799112229 Lactobacillus sp. ESL0413 Isolate Unclassified
24 2799112230 Lactobacillus sp. ESL0416 Isolate Unclassified
25 2820240463 Unclassified Firmicutes Th196P3bin85 Isolate Unclassified
26 2820630457 Unclassified Firmicutes Emb289P1bin119 Isolate Unclassified
27 2785510748 Lactobacillus sp. ESL0409 Isolate Apidae
28 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
29 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
30 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
31 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
32 2882334426 Lactobacillus sp. 2-3 Isolate Unclassified
33 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
34 2758568509 Lactobacillus bombicola ESL0234 Isolate Unclassified
35 2758568510 Lactobacillus bombicola ESL0233 Isolate Unclassified
36 2820360414 Unclassified Firmicutes Nt197P3bin121 Isolate Unclassified
37 2820375548 Unclassified Firmicutes Nt197P1bin8 Isolate Unclassified
38 2820615445 Unclassified Firmicutes Emb289P1bin132 Isolate Unclassified
39 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
40 3300002501 Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 Metagenome Termitidae
41 2958885890 Lactobacillus sp. ESL0234 Isolate Apidae
42 2961465228 Lactobacillus sp. ESL0233 Isolate Apidae
43 8017458139 Lactobacillus johnsonii CRL1647 Isolate Apidae
44 2529293168 Ruminiclostridium cellobioparum termitidis CT1112 Isolate Termitidae
45 2684622911 Lactobacillus kullabergensis Lb_186 Isolate Unclassified
46 2758568507 Lactobacillus bombicola ESL0237 Isolate Unclassified
47 2758568508 Lactobacillus bombicola ESL0236 Isolate Unclassified
48 2820453354 Unclassified Firmicutes Lab288P3bin172 Isolate Unclassified
49 2820488713 Unclassified Firmicutes Lab288P1bin69 Isolate Unclassified
50 2820490862 Unclassified Firmicutes Lab288P1bin64 Isolate Unclassified
51 2820512088 Unclassified Firmicutes Lab288P1bin4 Isolate Unclassified
52 2820533259 Unclassified Firmicutes Lab288P1bin140 Isolate Unclassified
53 2820560510 Unclassified Firmicutes Emb289P3bin72 Isolate Unclassified
54 2820685979 Unclassified Firmicutes Co191P1bin81 Isolate Unclassified
55 3300000333 Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony Metagenome Apidae
56 2968368220 Lactobacillus bombicola OCC3 Isolate Apidae
57 2971062614 Lactobacillus bombicola BI-4G Isolate Apidae
58 3004719924 Lactobacillus sp. W8174 Isolate Apidae
59 2912324399 Lactobacillus apis ESL0185 Isolate Apidae
60 2820259584 Unclassified Firmicutes Th196P3bin43 Isolate Unclassified
61 2820294436 Unclassified Firmicutes Th196P3bin104 Isolate Unclassified
62 2820581541 Unclassified Firmicutes Emb289P3bin127 Isolate Unclassified
63 2820702360 Unclassified Firmicutes Co191P1bin4 Isolate Unclassified
64 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
65 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
66 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
67 2684622912 Lactobacillus apis Lb_185 Isolate Unclassified
68 2758568506 Lactobacillus bombicola ESL0230 Isolate Unclassified
69 2799112220 Lactobacillus sp. ESL0411 Isolate Unclassified
70 2820380671 Unclassified Firmicutes Nt197P1bin4 Isolate Unclassified
71 2820600392 Unclassified Firmicutes Emb289P1bin52 Isolate Unclassified
72 2820607737 Unclassified Firmicutes Emb289P1bin48 Isolate Unclassified
73 2814123166 Lactobacillus apis LMG 26964 Isolate Apidae
74 3300005721 Honey bee gut microbiome from Carl Hayden Bee Research Center, Tucson, Arizona, USA - sample 1, colony 176 Metagenome Apidae
75 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
76 2758568505 Lactobacillus bombicola ESL0225 Isolate Unclassified
77 2820385248 Unclassified Firmicutes Nt197P1bin19 Isolate Unclassified
78 2820516196 Unclassified Firmicutes Lab288P1bin3 Isolate Unclassified
79 2820673891 Unclassified Firmicutes Co191P3bin18 Isolate Unclassified
80 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
81 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
82 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
83 2979949929 Lactobacillus sp. ESL0263 Isolate Apidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 JGI24703J35330_11733879 3300002501 Bacteria 2874
2 JGI24703J35330_11748374 3300002501 Bacteria 14872
3 Ga0123355_10042235 3300009826 Bacteria 7422
4 Ga0123355_10107654 3300009826 Bacteria 4366
5 Ga0123353_10000031 3300010167 Bacteria 160211
6 Ga0466706_216145 3300042599 Bacteria 1429
7 Ga0466728_124017 3300042620 Bacteria 4283
8 Ga0466728_128879 3300042620 Bacteria 3499
9 Ga0415639_002004 3300038395 Bacteria 58965
10 Ga0415639_060641 3300038395 Bacteria 3836
11 Ga0466693_198870 3300042592 Bacteria 3394
12 JGI24703J35330_11748731 3300002501 Bacteria 29662
13 Ga0123355_10000836 3300009826 Bacteria 42314
14 Ga0123355_10001827 3300009826 Bacteria 29774
15 Ga0123355_10280956 3300009826 Bacteria 2299
16 Ga0123356_10115279 3300010049 Bacteria 2603
17 Ga0466700_102167 3300042600 Bacteria 1890
18 Ga0466714_006129 3300042603 Bacteria 1265
19 Ga0466726_140068 3300042619 Bacteria 3754
20 Ga0466726_209048 3300042619 Bacteria 1831
21 Ga0415639_005596 3300038395 Unclassified 39897
22 Ga0466693_091172 3300042592 Bacteria 2027
23 Ga0466693_130472 3300042592 Bacteria 1635
24 Ga0068305_10016904 3300005083 Bacteria 88006
25 Ga0074278_152103 3300005721 Bacteria 23008
26 Ga0123355_10000417 3300009826 Bacteria 55420
27 Ga0123355_10288115 3300009826 Bacteria 2257
28 Ga0123356_10002078 3300010049 Bacteria 21603
29 Ga0123356_10026130 3300010049 Bacteria 5486
30 Ga0123356_10060362 3300010049 Bacteria 3539
31 Ga0123353_10068676 3300010167 Bacteria 5692
32 Ga0123353_10308844 3300010167 Bacteria 2408
33 Ga0466721_083763 3300042608 Bacteria 13763
34 Ga0415639_005501 3300038395 Bacteria 17934
35 Ga0415639_029358 3300038395 Bacteria 18403
36 Ga0415639_051553 3300038395 Bacteria 7759
37 JGI24695J34938_10000970 3300002450 Bacteria 26148
38 Ga0068305_10046174 3300005083 Bacteria 5078
39 Ga0123355_10000180 3300009826 Bacteria 77979
40 Ga0123355_10000913 3300009826 Bacteria 40903
41 Ga0123355_10032317 3300009826 Bacteria 8492
42 Ga0123355_10290944 3300009826 Bacteria 2242
43 Ga0123356_10118644 3300010049 Bacteria 2569
44 Ga0466721_186361 3300042608 Bacteria 8064
45 Ga0466726_416718 3300042619 Bacteria 8118
46 Ga0415639_005725 3300038395 Bacteria 7233
47 Ga0415639_006261 3300038395 Bacteria 24284
48 Ga0466727_306349 3300042655 Bacteria 6399
49 HBC_ctgsDRAFT_1052828 3300000333 Unclassified 986
50 JGI24703J35330_11746652 3300002501 Bacteria 5485
51 Ga0074278_143879 3300005721 Bacteria 3061
52 Ga0123355_10000545 3300009826 Bacteria 50565
53 Ga0123355_10278593 3300009826 Bacteria 2312
54 Ga0123353_10084929 3300010167 Bacteria 5097
55 Ga0466721_100978 3300042608 Bacteria 228571
56 Ga0415639_005724 3300038395 Bacteria 12757
57 Ga0415639_040536 3300038395 Bacteria 8181
58 Ga0415639_108336 3300038395 Bacteria 1610
59 Ga0123357_10153548 3300009784 Bacteria 2784
60 Ga0123355_10000480 3300009826 Bacteria 53005
61 Ga0123355_10023101 3300009826 Bacteria 9979
62 Ga0466706_085272 3300042599 Bacteria 1924
63 Ga0466700_084561 3300042600 Bacteria 5608
64 Ga0466714_128441 3300042603 Bacteria 5937
65 Ga0466722_084229 3300042609 Bacteria 96990
66 Ga0466728_083691 3300042620 Unclassified 7264
67 Ga0415639_005748 3300038395 Bacteria 5803
68 Ga0466727_150848 3300042655 Bacteria 3969
69 JGI24703J35330_11748182 3300002501 Bacteria 11618
70 Ga0123355_10025924 3300009826 Bacteria 9448
71 Ga0123355_10174142 3300009826 Bacteria 3209
72 Ga0123355_10374865 3300009826 Bacteria 1860
73 Ga0123355_10434003 3300009826 Bacteria 1668
74 Ga0123353_10257547 3300010167 Bacteria 2698
75 Ga0466706_016330 3300042599 Bacteria 1295
76 Ga0466713_100568 3300042602 Bacteria 78535
77 Ga0415639_059330 3300038395 Bacteria 3817
78 Ga0466705_144292 3300042612 Bacteria 7905
79 Ga0123357_10077853 3300009784 Bacteria 4371
80 Ga0123355_10000173 3300009826 Bacteria 78945
81 Ga0123356_10002775 3300010049 Bacteria 18597
82 Ga0123356_10018589 3300010049 Bacteria 6596
83 Ga0123353_10399230 3300010167 Bacteria 2047
84 Ga0466706_171479 3300042599 Bacteria 2768
85 Ga0466711_095413 3300042615 Bacteria 2392
86 Ga0415639_005747 3300038395 Bacteria 29446

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF02873 MurB_C UDP-N-acetylenolpyruvoylglucosamine reductase, C-terminal domain 245 343 0.98
PF01565 FAD_binding_4 FAD binding domain 33 150 0.87

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF02873 GO:0008762 UDP-N-acetylmuramate dehydrogenase activity MF
PF01565 GO:0050660 flavin adenine dinucleotide binding MF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.