Protein Family IF12093
Metagenome
Isolate
226
Members
115
Samples
139
Scaffolds
312.61
Avg Length
Representative Sequence
- ID
- iso_pr_bacteria|2820520043|2820521918|
- Length
- 378 aa
- Sequence
- MESITSFNLVVLNSIQQIKEKHNLPNSLLSITLKLCYNHDKCHYRTPQSLAILKIQNNLSGGIHIMIANIKNVVKRYGDTTALDHLNLDVAEGEILGLLGPNGAGKTTAIRVLCGLVDADAGEVQVFGQRQSVRNLSPRHDIGLVTQEITVFKDLSAIENLRYFGGLYGLRGAELDTNVKEMLEFVGLTERAKKRPGTFSGGMQRRLNIACALVHKPKLVIMDEPTVGIDPQSRNHILESVKKIAQNGTTVVYTSHYMEEVQAICNRIAIMDAGRVIAEGSIDELMNRIQYEDRVRLHAATPSDSLTEELRAISGVKSVTVNDGHYLIISGAGSGNINRIMTVAQRHTSILSVSEDKPSLEDVFLTLTGKRLRDEGEV
Sample Types
Isolate
38.5%
Metagenome
61.5%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Unclassified
35.5%
Termitidae
24.5%
Scarabaeidae
5.5%
Apidae
5.5%
Pyralidae
5.5%
Elmidae
3.6%
Kalotermitidae
3.6%
Tenebrionidae
2.7%
Stratiomyidae
1.8%
Rhinotermitidae
1.8%
Bombycidae
1.8%
Culicidae
1.8%
Ocypodidae
0.9%
Portunidae
0.9%
Armadillidiidae
0.9%
Drosophilidae
0.9%
Noctuidae
0.9%
Eresidae
0.9%
Curculionidae
0.9%
Taxonomy
Archaea
0
Bacteria
215
Eukaryota
0
Viruses
0
Unclassified
11
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2822450720 | Bacillus toyonensis AFS052650 | Isolate | Scarabaeidae |
| 2 | 2864782175 | Bacillus toyonensis S00025 | Isolate | Elmidae |
| 3 | 2731957677 | Alkalihalobacillus trypoxylicola NBRC 102646 | Isolate | Scarabaeidae |
| 4 | 2820353569 | Unclassified Firmicutes Nt197P3bin28 | Isolate | Unclassified |
| 5 | 2820479655 | Unclassified Firmicutes Lab288P1bin77 | Isolate | Unclassified |
| 6 | 2820492969 | Unclassified Firmicutes Lab288P1bin6 | Isolate | Unclassified |
| 7 | 2820516196 | Unclassified Firmicutes Lab288P1bin3 | Isolate | Unclassified |
| 8 | 2820520043 | Unclassified Firmicutes Lab288P1bin24 | Isolate | Unclassified |
| 9 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 10 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 11 | 641736255 | Paenibacillus larvae larvae BRL-230010 | Isolate | Unclassified |
| 12 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 13 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 14 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 15 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 16 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 17 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 18 | 2978778678 | Bacillus cereus 25 | Isolate | Ocypodidae |
| 19 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 20 | 8114555646 | Enterococcus sp. DIV1094 | Isolate | |
| 21 | 2836667214 | Paenibacillus larvae larvae B-3650 | Isolate | Apidae |
| 22 | 2849099867 | Paenibacillus larvae larvae ERIC_I | Isolate | Unclassified |
| 23 | 2852337885 | Paenibacillus protaetiae FW100M-2 | Isolate | Scarabaeidae |
| 24 | 2864816158 | Priestia aryabhattai S00060 | Isolate | Elmidae |
| 25 | 2864981449 | Sporosarcina sp. S00266 | Isolate | Elmidae |
| 26 | 2820463629 | Unclassified Firmicutes Lab288P3bin124 | Isolate | Unclassified |
| 27 | 2820617402 | Unclassified Firmicutes Emb289P1bin131 | Isolate | Unclassified |
| 28 | 2820627938 | Unclassified Firmicutes Emb289P1bin122 | Isolate | Unclassified |
| 29 | 2820681712 | Unclassified Firmicutes Co191P1bin84 | Isolate | Unclassified |
| 30 | 643886087 | Bacillus thuringiensis sv. kurstaki T03a001 | Isolate | Pyralidae |
| 31 | 643886090 | Bacillus thuringiensis sv. pakistani t13001 | Isolate | Unclassified |
| 32 | 8061100935 | Bacillus thuringiensis sv. japonensis 62 | Isolate | |
| 33 | 8064008355 | Heyndrickxia oleronia | Isolate | Unclassified |
| 34 | 2969145278 | Bacillus cereus 29 | Isolate | Portunidae |
| 35 | 8114544644 | Enterococcus sp. 9E7_DIV0242 9E7_DIV0242 | Isolate | |
| 36 | 2820854745 | Unclassified Actinobacteria Lab288P3bin234 | Isolate | Unclassified |
| 37 | 2827179085 | Paenibacillus alvei DSM 29 | Isolate | Apidae |
| 38 | 2849104611 | Paenibacillus larvae larvae Eric_IV | Isolate | Apidae |
| 39 | 2912849059 | Bacillus thuringiensis sv. berliner ATCC 10792 | Isolate | Pyralidae |
| 40 | 2209111004 | Macrotermes natalensis queen gut microbiome | Metagenome | Termitidae |
| 41 | 2820620956 | Unclassified Firmicutes Emb289P1bin128 | Isolate | Unclassified |
| 42 | 2820626145 | Unclassified Firmicutes Emb289P1bin123 | Isolate | Unclassified |
| 43 | 2820709481 | Unclassified Firmicutes Co191P1bin30 | Isolate | Unclassified |
| 44 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 45 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 46 | 3300056564 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS_oats (Improved Draft) | Metagenome | Tenebrionidae |
| 47 | 8030337018 | Tissierella sp. Yu-01 | Isolate | Stratiomyidae |
| 48 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 49 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 50 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 51 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 52 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 53 | 3300012829 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG | Metagenome | Armadillidiidae |
| 54 | 2850744690 | Paenibacillus larvae larvae DSM 25430 | Isolate | Apidae |
| 55 | 2820547636 | Unclassified Firmicutes Lab288P1bin10 | Isolate | Unclassified |
| 56 | 2820598593 | Unclassified Firmicutes Emb289P1bin53 | Isolate | Unclassified |
| 57 | 2820666966 | Unclassified Firmicutes Co191P3bin39 | Isolate | Unclassified |
| 58 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 59 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
| 60 | 643886085 | Bacillus thuringiensis sv. berliner ATCC 10792 | Isolate | Pyralidae |
| 61 | 643886091 | Bacillus thuringiensis sv. thuringiensis T01001 | Isolate | Pyralidae |
| 62 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 63 | 2537562000 | Bacillus cereus HD73 | Isolate | Pyralidae |
| 64 | 2574180310 | Bacillus licheniformis CG-B52 | Isolate | Unclassified |
| 65 | 2576861701 | Paenibacillus sp. JCM 10914 | Isolate | Termitidae |
| 66 | 2820690275 | Unclassified Firmicutes Co191P1bin72 | Isolate | Unclassified |
| 67 | 8061045771 | Bacillus thuringiensis sv. kurstaki BGSC 4D1 | Isolate | Bombycidae |
| 68 | 8108568626 | Enterococcus sp. DIV1094 | Isolate | |
| 69 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 70 | 3300002501 | Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 | Metagenome | Termitidae |
| 71 | 3300007767 | Drosophila gut microbial communities from New York, USA - Drosophila suzukii male 6 gut | Metagenome | Drosophilidae |
| 72 | 3300012805 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E11 MG | Metagenome | |
| 73 | 2916858470 | Heyndrickxia oleronia | Isolate | Unclassified |
| 74 | 2916873227 | Bacillus thuringiensis sv. berliner ATCC 10792 | Isolate | Pyralidae |
| 75 | 2563367190 | Bacillus thuringiensis sv. aizawai Leapi01 | Isolate | Noctuidae |
| 76 | 2791355481 | Bacillus sp. ZY-1-1 | Isolate | Scarabaeidae |
| 77 | 2820288918 | Unclassified Firmicutes Th196P3bin137 | Isolate | Unclassified |
| 78 | 2820294436 | Unclassified Firmicutes Th196P3bin104 | Isolate | Unclassified |
| 79 | 2820301196 | Unclassified Firmicutes Th196P1bin8 | Isolate | Unclassified |
| 80 | 2820499546 | Unclassified Firmicutes Lab288P1bin54 | Isolate | Unclassified |
| 81 | 2820688768 | Unclassified Firmicutes Co191P1bin74 | Isolate | Unclassified |
| 82 | 8022725327 | Bacillus sp. SN10 | Isolate | Eresidae |
| 83 | 8022781829 | Bacillus sp. VKPM B-3276 | Isolate | Culicidae |
| 84 | 8030343600 | Proteiniborus sp. MB09-C3 | Isolate | Stratiomyidae |
| 85 | 8064531044 | Terrisporobacter mayombei DSM 6539 | Isolate | Unclassified |
| 86 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 87 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 88 | 3300002508 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 | Metagenome | Termitidae |
| 89 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 90 | 2864909992 | Bacillus velezensis S00166 | Isolate | Elmidae |
| 91 | 2529293168 | Ruminiclostridium cellobioparum termitidis CT1112 | Isolate | Termitidae |
| 92 | 2634166424 | Clostridium sp. L74 | Isolate | Scarabaeidae |
| 93 | 2820453354 | Unclassified Firmicutes Lab288P3bin172 | Isolate | Unclassified |
| 94 | 2820488713 | Unclassified Firmicutes Lab288P1bin69 | Isolate | Unclassified |
| 95 | 2820512088 | Unclassified Firmicutes Lab288P1bin4 | Isolate | Unclassified |
| 96 | 2820533259 | Unclassified Firmicutes Lab288P1bin140 | Isolate | Unclassified |
| 97 | 2820537337 | Unclassified Firmicutes Lab288P1bin137 | Isolate | Unclassified |
| 98 | 2820560510 | Unclassified Firmicutes Emb289P3bin72 | Isolate | Unclassified |
| 99 | 2820606014 | Unclassified Firmicutes Emb289P1bin49 | Isolate | Unclassified |
| 100 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 101 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 102 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 103 | 8061039349 | Bacillus thuringiensis sv. galleriae BGSC 4G4 | Isolate | Bombycidae |
| 104 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 105 | 2822232166 | Bacillus toyonensis AFS084242 | Isolate | Scarabaeidae |
| 106 | 2523231078 | Paenibacillus larvae larvae 4-309, DSM 25430 | Isolate | Apidae |
| 107 | 2820619171 | Unclassified Firmicutes Emb289P1bin130 | Isolate | Unclassified |
| 108 | 2820637417 | Unclassified Firmicutes Emb289P1bin108 | Isolate | Unclassified |
| 109 | 3300056856 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) | Metagenome | Tenebrionidae |
| 110 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 111 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 112 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 113 | 2971438493 | Paenibacillus apiarius NRRL B-23460 | Isolate | Apidae |
| 114 | 3300003973 | Ips typographus gut microbial communities from Hannover, Germany - first DNA extraction october 2014, adult beetle | Metagenome | Curculionidae |
| 115 | 3300012813 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E11 MG | Metagenome | Culicidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0562375_0063 | 3300056856 | Bacteria | 420368 |
| 2 | Ga0415639_044542 | 3300038395 | Bacteria | 25483 |
| 3 | Ga0466693_277930 | 3300042592 | Unclassified | 2710 |
| 4 | Ga0466693_307994 | 3300042592 | Bacteria | 1079 |
| 5 | Ga0466693_328720 | 3300042592 | Bacteria | 1343 |
| 6 | Ga0123355_10009217 | 3300009826 | Bacteria | 14979 |
| 7 | Ga0123355_10026000 | 3300009826 | Bacteria | 9435 |
| 8 | Ga0123355_10026791 | 3300009826 | Bacteria | 9302 |
| 9 | Ga0123355_10046643 | 3300009826 | Bacteria | 7046 |
| 10 | Ga0123355_10058722 | 3300009826 | Bacteria | 6221 |
| 11 | Ga0123355_10087291 | 3300009826 | Bacteria | 4958 |
| 12 | Ga0123355_10202849 | 3300009826 | Bacteria | 2892 |
| 13 | Ga0123355_10220012 | 3300009826 | Bacteria | 2733 |
| 14 | Ga0123355_10521021 | 3300009826 | Bacteria | 1454 |
| 15 | Ga0123355_10657743 | 3300009826 | Bacteria | 1220 |
| 16 | Ga0123353_10000339 | 3300010167 | Bacteria | 57571 |
| 17 | Ga0160464_100856 | 3300012805 | Bacteria | 15937 |
| 18 | AustNasuHG_c1000055 | 3300000089 | Bacteria | 29913 |
| 19 | JGI24695J34938_10041528 | 3300002450 | Unclassified | 2065 |
| 20 | JGI24703J35330_11748855 | 3300002501 | Bacteria | 55590 |
| 21 | Ga0072940_1072494 | 3300005200 | Bacteria | 11757 |
| 22 | Ga0466731_010364 | 3300042622 | Bacteria | 7680 |
| 23 | Ga0466729_105466 | 3300042621 | Bacteria | 24259 |
| 24 | Ga0466698_008584 | 3300042610 | Bacteria | 9626 |
| 25 | Ga0123355_10000773 | 3300009826 | Bacteria | 43679 |
| 26 | Ga0123355_10010528 | 3300009826 | Bacteria | 14189 |
| 27 | Ga0123355_10018540 | 3300009826 | Bacteria | 11045 |
| 28 | Ga0123355_10038409 | 3300009826 | Bacteria | 7784 |
| 29 | Ga0123355_10060535 | 3300009826 | Unclassified | 6114 |
| 30 | Ga0123353_10000331 | 3300010167 | Bacteria | 58268 |
| 31 | Ga0123353_10291810 | 3300010167 | Bacteria | 2496 |
| 32 | JGI24702J35022_10020991 | 3300002462 | Bacteria | 3545 |
| 33 | JGI24702J35022_10098222 | 3300002462 | Bacteria | 1600 |
| 34 | JGI24703J35330_11747088 | 3300002501 | Bacteria | 6124 |
| 35 | JGI24703J35330_11747809 | 3300002501 | Bacteria | 8389 |
| 36 | Ga0063521_1001678 | 3300003973 | Bacteria | 5745 |
| 37 | Ga0105553_1018274 | 3300007767 | Bacteria | 4789 |
| 38 | Ga0415639_000491 | 3300038395 | Bacteria | 42295 |
| 39 | Ga0466693_244556 | 3300042592 | Bacteria | 2584 |
| 40 | Ga0466717_225657 | 3300042604 | Bacteria | 4579 |
| 41 | Ga0123355_10003342 | 3300009826 | Bacteria | 22961 |
| 42 | Ga0123355_10006486 | 3300009826 | Bacteria | 17349 |
| 43 | Ga0123355_10026739 | 3300009826 | Unclassified | 9313 |
| 44 | Ga0123355_10047232 | 3300009826 | Bacteria | 7001 |
| 45 | Ga0123355_10108452 | 3300009826 | Bacteria | 4346 |
| 46 | Ga0123355_10235082 | 3300009826 | Bacteria | 2609 |
| 47 | Ga0123355_10575655 | 3300009826 | Bacteria | 1349 |
| 48 | Ga0123356_10028578 | 3300010049 | Bacteria | 5224 |
| 49 | Ga0123353_10146398 | 3300010167 | Bacteria | 3776 |
| 50 | Ga0123353_10179953 | 3300010167 | Bacteria | 3348 |
| 51 | 2212191332 | 2209111004 | Bacteria | 23935 |
| 52 | JGI24703J35330_11747320 | 3300002501 | Unclassified | 6557 |
| 53 | Ga0466697_216394 | 3300042611 | Bacteria | 1674 |
| 54 | Ga0466703_101908 | 3300042636 | Bacteria | 18351 |
| 55 | Ga0466724_09474 | 3300042649 | Bacteria | 4941 |
| 56 | Ga0466725_283285 | 3300042654 | Bacteria | 2408 |
| 57 | Ga0466701_035819 | 3300042598 | Bacteria | 64768 |
| 58 | Ga0466719_079390 | 3300042606 | Bacteria | 35022 |
| 59 | Ga0123355_10001840 | 3300009826 | Bacteria | 29692 |
| 60 | Ga0123355_10014493 | 3300009826 | Bacteria | 12335 |
| 61 | Ga0123355_10051908 | 3300009826 | Bacteria | 6654 |
| 62 | Ga0123355_10075433 | 3300009826 | Bacteria | 5397 |
| 63 | Ga0123355_10213141 | 3300009826 | Bacteria | 2794 |
| 64 | Ga0123356_10003012 | 3300010049 | Bacteria | 17791 |
| 65 | Ga0123356_10027819 | 3300010049 | Bacteria | 5298 |
| 66 | Ga0123356_10470046 | 3300010049 | Bacteria | 1409 |
| 67 | JGI24703J35330_11747856 | 3300002501 | Bacteria | 8668 |
| 68 | Ga0072940_1083849 | 3300005200 | Bacteria | 24233 |
| 69 | Ga0466697_065075 | 3300042611 | Bacteria | 5036 |
| 70 | Ga0466697_223525 | 3300042611 | Bacteria | 2644 |
| 71 | Ga0562377_0011 | 3300056842 | Bacteria | 1259346 |
| 72 | Ga0160467_100177 | 3300012829 | Bacteria | 87295 |
| 73 | Ga0466692_188482 | 3300042591 | Bacteria | 50930 |
| 74 | Ga0123355_10000335 | 3300009826 | Bacteria | 61011 |
| 75 | Ga0123355_10008885 | 3300009826 | Bacteria | 15215 |
| 76 | Ga0123355_10022876 | 3300009826 | Bacteria | 10021 |
| 77 | Ga0123355_10035861 | 3300009826 | Bacteria | 8063 |
| 78 | Ga0123355_10303002 | 3300009826 | Bacteria | 2176 |
| 79 | Ga0123356_10001150 | 3300010049 | Bacteria | 29279 |
| 80 | Ga0123356_10007414 | 3300010049 | Unclassified | 10946 |
| 81 | Ga0123356_10107214 | 3300010049 | Unclassified | 2691 |
| 82 | JGI24695J34938_10000798 | 3300002450 | Bacteria | 29293 |
| 83 | JGI24695J34938_10044433 | 3300002450 | Bacteria | 1976 |
| 84 | Ga0466704_400678 | 3300042643 | Bacteria | 2680 |
| 85 | Ga0160470_100295 | 3300012813 | Bacteria | 31165 |
| 86 | Ga0415639_001484 | 3300038395 | Bacteria | 4727 |
| 87 | Ga0415639_011583 | 3300038395 | Bacteria | 11251 |
| 88 | Ga0466693_240461 | 3300042592 | Bacteria | 1180 |
| 89 | Ga0466696_133662 | 3300042596 | Bacteria | 1429 |
| 90 | Ga0466721_090497 | 3300042608 | Bacteria | 167057 |
| 91 | Ga0123355_10000048 | 3300009826 | Bacteria | 122485 |
| 92 | Ga0123355_10002328 | 3300009826 | Bacteria | 26827 |
| 93 | Ga0123355_10002908 | 3300009826 | Bacteria | 24316 |
| 94 | Ga0123355_10015121 | 3300009826 | Bacteria | 12110 |
| 95 | Ga0123355_10701116 | 3300009826 | Bacteria | 1162 |
| 96 | Ga0123356_10122566 | 3300010049 | Bacteria | 2532 |
| 97 | JGI24695J34938_10039348 | 3300002450 | Bacteria | 2137 |
| 98 | Ga0072940_1124411 | 3300005200 | Bacteria | 4588 |
| 99 | Ga0466697_105026 | 3300042611 | Bacteria | 3668 |
| 100 | Ga0466731_319733 | 3300042622 | Bacteria | 1302 |
| 101 | Ga0466734_090013 | 3300042623 | Bacteria | 1374 |
| 102 | Ga0466730_091419 | 3300042625 | Unclassified | 1726 |
| 103 | Ga0530661_000004 | 3300056564 | Bacteria | 460556 |
| 104 | Ga0415639_021750 | 3300038395 | Unclassified | 5465 |
| 105 | Ga0415639_036057 | 3300038395 | Bacteria | 21086 |
| 106 | Ga0466693_139618 | 3300042592 | Bacteria | 1922 |
| 107 | Ga0466693_258303 | 3300042592 | Bacteria | 2754 |
| 108 | Ga0466718_102944 | 3300042617 | Bacteria | 5062 |
| 109 | Ga0466700_367624 | 3300042600 | Bacteria | 1573 |
| 110 | Ga0466707_080141 | 3300042601 | Bacteria | 11368 |
| 111 | Ga0466721_101452 | 3300042608 | Bacteria | 8491 |
| 112 | Ga0123355_10000135 | 3300009826 | Bacteria | 86867 |
| 113 | Ga0123355_10000604 | 3300009826 | Bacteria | 48507 |
| 114 | Ga0123355_10004344 | 3300009826 | Bacteria | 20618 |
| 115 | Ga0123355_10012055 | 3300009826 | Bacteria | 13375 |
| 116 | Ga0123355_10048466 | 3300009826 | Bacteria | 6907 |
| 117 | Ga0123355_10093016 | 3300009826 | Bacteria | 4774 |
| 118 | Ga0123353_10622045 | 3300010167 | Bacteria | 1537 |
| 119 | JGI24695J34938_10013886 | 3300002450 | Unclassified | 4208 |
| 120 | JGI24700J35501_10930704 | 3300002508 | Bacteria | 19318 |
| 121 | Ga0466734_072933 | 3300042623 | Bacteria | 1284 |
| 122 | Ga0466724_37484 | 3300042649 | Bacteria | 2350 |
| 123 | Ga0415639_186959 | 3300038395 | Bacteria | 1910 |
| 124 | Ga0466696_332276 | 3300042596 | Bacteria | 28400 |
| 125 | Ga0466699_015444 | 3300042597 | Bacteria | 3080 |
| 126 | Ga0466729_141418 | 3300042621 | Bacteria | 2803 |
| 127 | Ga0466707_019134 | 3300042601 | Bacteria | 1329 |
| 128 | Ga0466698_463209 | 3300042610 | Bacteria | 2989 |
| 129 | Ga0123355_10001865 | 3300009826 | Bacteria | 29577 |
| 130 | Ga0123355_10063709 | 3300009826 | Bacteria | 5944 |
| 131 | Ga0123355_10251718 | 3300009826 | Bacteria | 2485 |
| 132 | Ga0123355_10286001 | 3300009826 | Bacteria | 2269 |
| 133 | Ga0123355_10754146 | 3300009826 | Bacteria | 1099 |
| 134 | Ga0123353_10004601 | 3300010167 | Unclassified | 17812 |
| 135 | Ga0123353_10947931 | 3300010167 | Bacteria | 1164 |
| 136 | JGI24695J34938_10000115 | 3300002450 | Bacteria | 71817 |
| 137 | JGI24695J34938_10082074 | 3300002450 | Bacteria | 1331 |
| 138 | JGI24702J35022_10000577 | 3300002462 | Bacteria | 22264 |
| 139 | JGI24703J35330_11747987 | 3300002501 | Bacteria | 9676 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.