Protein Family IF12064
Metagenome
Isolate
115
Members
51
Samples
102
Scaffolds
248.5
Avg Length
Representative Sequence
- ID
- iso_pr_bacteria|2820391468|2820392499|
- Length
- 282 aa
- Sequence
- MTPTEQLTKWINQSKSTVFFGGAGVSTESGIPDFRSDSGLYQARKVYGYPXEELLSHRFFMRHTELFFRYYRENXIXXDXRPNAAHLALAKLEARGLLRAVVTQNIDGLHQAAGSEKVLELHGSNWRQYCVKCGARYDLDYILAQEGVPKCXACGGVVRPDVVLYGEQLDGGVMDAAARAIGTAELLIVGGTSLAVYPAAGLLEYFRGAHLVLINKSETPYDARADLVIHDAIGKVLGRSRQGCDVPGEQAVGRVLVRRAARIAVGHVLAAALDVPVVEIGE
Sample Types
Isolate
11.3%
Metagenome
88.7%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
31.4%
Unclassified
29.4%
Kalotermitidae
25.5%
Rhinotermitidae
5.9%
Termopsidae
3.9%
Hodotermitidae
2.0%
Passalidae
2.0%
Taxonomy
Archaea
7
Bacteria
96
Eukaryota
0
Viruses
0
Unclassified
12
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 2 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 3 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 4 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 5 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 6 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 7 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 8 | 2820391468 | Unclassified Firmicutes Nc150P3bin1 | Isolate | Unclassified |
| 9 | 2820469612 | Unclassified Firmicutes Lab288P1bin92 | Isolate | Unclassified |
| 10 | 2820941830 | Unclassified Actinobacteria Cu122P5bin49 | Isolate | Unclassified |
| 11 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 12 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 13 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 14 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 15 | 2773857691 | Unclassified Methanomassiliicoccaceae Nt197P4bin4 | Isolate | Unclassified |
| 16 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 17 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 18 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 19 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 20 | 2820560510 | Unclassified Firmicutes Emb289P3bin72 | Isolate | Unclassified |
| 21 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 22 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 23 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 24 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 25 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 26 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 27 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 28 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 29 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 30 | 2772190995 | Unclassified Bathyarchaeota Lab288P3bin115 | Isolate | Unclassified |
| 31 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 32 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 33 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 34 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 35 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 36 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 37 | 2820282995 | Unclassified Firmicutes Th196P3bin147 | Isolate | Unclassified |
| 38 | 2820483401 | Unclassified Firmicutes Lab288P1bin74 | Isolate | Unclassified |
| 39 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 40 | 2820418027 | Unclassified Firmicutes Lab288P3bin85 | Isolate | Unclassified |
| 41 | 2772190997 | Unclassified Bathyarchaeota Lab288P4bin25 | Isolate | Unclassified |
| 42 | 2820897376 | Unclassified Actinobacteria Lab288P1bin101 | Isolate | Unclassified |
| 43 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 44 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 45 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 46 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 47 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 48 | 2820223845 | Unclassified Firmicutes Th196P4bin57 | Isolate | Unclassified |
| 49 | 2820323050 | Unclassified Firmicutes Nt197P3bin84 | Isolate | Unclassified |
| 50 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 51 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | JGI24702J35022_10128954 | 3300002462 | Bacteria | 1403 |
| 2 | Ga0466705_388251 | 3300042612 | Unclassified | 10932 |
| 3 | Ga0466723_032847 | 3300042618 | Bacteria | 1190 |
| 4 | Ga0123353_10009531 | 3300010167 | Bacteria | 13421 |
| 5 | Ga0123353_10026581 | 3300010167 | Unclassified | 8846 |
| 6 | Ga0123353_10327189 | 3300010167 | Bacteria | 2322 |
| 7 | Ga0123353_10330270 | 3300010167 | Bacteria | 2309 |
| 8 | Ga0123354_10331423 | 3300010882 | Unclassified | 1387 |
| 9 | Ga0466731_152432 | 3300042622 | Bacteria | 6934 |
| 10 | Ga0466702_245583 | 3300042635 | Unclassified | 1383 |
| 11 | Ga0466703_249605 | 3300042636 | Bacteria | 1279 |
| 12 | Ga0466709_292483 | 3300042648 | Bacteria | 2771 |
| 13 | Ga0466706_034616 | 3300042599 | Bacteria | 18378 |
| 14 | Ga0466707_330860 | 3300042601 | Unclassified | 1055 |
| 15 | Ga0466722_184615 | 3300042609 | Bacteria | 8069 |
| 16 | Ga0466692_100103 | 3300042591 | Bacteria | 6839 |
| 17 | Ga0072940_1277974 | 3300005200 | Bacteria | 3511 |
| 18 | Ga0466715_362442 | 3300042616 | Bacteria | 2235 |
| 19 | Ga0123353_10287597 | 3300010167 | Unclassified | 2519 |
| 20 | Ga0123353_10666882 | 3300010167 | Bacteria | 1468 |
| 21 | Ga0466702_273243 | 3300042635 | Bacteria | 2015 |
| 22 | Ga0466704_349366 | 3300042643 | Unclassified | 8121 |
| 23 | Ga0466724_34718 | 3300042649 | Bacteria | 3475 |
| 24 | Ga0466719_324566 | 3300042606 | Bacteria | 2968 |
| 25 | Ga0466722_113346 | 3300042609 | Bacteria | 18095 |
| 26 | Ga0466692_020198 | 3300042591 | Unclassified | 2951 |
| 27 | Ga0466692_167080 | 3300042591 | Bacteria | 1827 |
| 28 | IMNBL1DRAFT_c0000195 | 3300000062 | Bacteria | 53047 |
| 29 | JGI24696J40584_12959870 | 3300002834 | Bacteria | 5805 |
| 30 | Ga0466705_492159 | 3300042612 | Bacteria | 18817 |
| 31 | Ga0466711_485617 | 3300042615 | Archaea | 3162 |
| 32 | Ga0123357_10005408 | 3300009784 | Archaea | 15289 |
| 33 | Ga0123357_10298742 | 3300009784 | Archaea | 1631 |
| 34 | Ga0123353_10002771 | 3300010167 | Bacteria | 21885 |
| 35 | Ga0123353_10375079 | 3300010167 | Bacteria | 2131 |
| 36 | Ga0123353_10622628 | 3300010167 | Bacteria | 1536 |
| 37 | Ga0466702_290527 | 3300042635 | Bacteria | 2166 |
| 38 | Ga0466716_158469 | 3300042605 | Bacteria | 6247 |
| 39 | Ga0466719_534236 | 3300042606 | Bacteria | 1532 |
| 40 | Ga0466692_082057 | 3300042591 | Bacteria | 2886 |
| 41 | Ga0466718_088130 | 3300042617 | Bacteria | 8343 |
| 42 | Ga0466728_294346 | 3300042620 | Bacteria | 2668 |
| 43 | Ga0466728_408609 | 3300042620 | Bacteria | 1379 |
| 44 | Ga0123353_10005362 | 3300010167 | Bacteria | 16805 |
| 45 | Ga0123353_10104765 | 3300010167 | Bacteria | 4558 |
| 46 | Ga0466734_084843 | 3300042623 | Archaea | 1879 |
| 47 | Ga0466713_155069 | 3300042602 | Bacteria | 27732 |
| 48 | Ga0466722_220321 | 3300042609 | Bacteria | 4302 |
| 49 | Ga0415639_038961 | 3300038395 | Bacteria | 3811 |
| 50 | Ga0466691_116582 | 3300042593 | Bacteria | 15504 |
| 51 | Ga0466696_246516 | 3300042596 | Bacteria | 10890 |
| 52 | Ga0466705_384053 | 3300042612 | Bacteria | 2642 |
| 53 | Ga0466726_445589 | 3300042619 | Bacteria | 1119 |
| 54 | Ga0466728_336599 | 3300042620 | Bacteria | 4169 |
| 55 | Ga0123356_10427098 | 3300010049 | Bacteria | 1469 |
| 56 | Ga0123353_10000196 | 3300010167 | Bacteria | 76783 |
| 57 | Ga0123353_10077875 | 3300010167 | Unclassified | 5328 |
| 58 | Ga0466729_302360 | 3300042621 | Unclassified | 3680 |
| 59 | Ga0466702_063360 | 3300042635 | Bacteria | 1266 |
| 60 | Ga0466716_467143 | 3300042605 | Bacteria | 1699 |
| 61 | JGI24702J35022_10000752 | 3300002462 | Bacteria | 20000 |
| 62 | Ga0068302_10060608 | 3300005071 | Unclassified | 6318 |
| 63 | Ga0466705_450463 | 3300042612 | Bacteria | 1098 |
| 64 | Ga0466715_091584 | 3300042616 | Bacteria | 17765 |
| 65 | Ga0466726_464125 | 3300042619 | Bacteria | 1618 |
| 66 | Ga0123353_10247833 | 3300010167 | Bacteria | 2762 |
| 67 | Ga0123353_10519717 | 3300010167 | Bacteria | 1728 |
| 68 | Ga0466703_116257 | 3300042636 | Bacteria | 2118 |
| 69 | Ga0466717_139182 | 3300042604 | Bacteria | 2411 |
| 70 | Ga0466719_225057 | 3300042606 | Bacteria | 11880 |
| 71 | Ga0072940_1178717 | 3300005200 | Bacteria | 1790 |
| 72 | Ga0466711_342379 | 3300042615 | Bacteria | 5573 |
| 73 | Ga0466711_403183 | 3300042615 | Bacteria | 3058 |
| 74 | Ga0466726_201890 | 3300042619 | Bacteria | 3311 |
| 75 | Ga0123356_10004167 | 3300010049 | Bacteria | 14993 |
| 76 | Ga0123353_10180889 | 3300010167 | Bacteria | 3338 |
| 77 | Ga0466703_183876 | 3300042636 | Bacteria | 13987 |
| 78 | Ga0466704_023020 | 3300042643 | Bacteria | 30517 |
| 79 | Ga0466704_050705 | 3300042643 | Bacteria | 60540 |
| 80 | Ga0466708_054789 | 3300042652 | Bacteria | 2606 |
| 81 | Ga0466700_027993 | 3300042600 | Bacteria | 3785 |
| 82 | Ga0466707_235562 | 3300042601 | Bacteria | 1686 |
| 83 | Ga0466713_140965 | 3300042602 | Bacteria | 4090 |
| 84 | Ga0466717_016115 | 3300042604 | Bacteria | 2478 |
| 85 | Ga0466719_407190 | 3300042606 | Bacteria | 2562 |
| 86 | Ga0415639_005313 | 3300038395 | Bacteria | 3915 |
| 87 | Ga0415639_035211 | 3300038395 | Bacteria | 11718 |
| 88 | Ga0466696_337223 | 3300042596 | Bacteria | 1180 |
| 89 | Ga0466705_225134 | 3300042612 | Bacteria | 1197 |
| 90 | JGI24705J35276_12236152 | 3300002504 | Bacteria | 7564 |
| 91 | Ga0466715_203996 | 3300042616 | Unclassified | 2344 |
| 92 | Ga0466715_268647 | 3300042616 | Bacteria | 3880 |
| 93 | Ga0466723_374065 | 3300042618 | Bacteria | 3450 |
| 94 | Ga0123353_10034942 | 3300010167 | Bacteria | 7855 |
| 95 | Ga0123353_10104795 | 3300010167 | Bacteria | 4557 |
| 96 | Ga0123353_10778236 | 3300010167 | Bacteria | 1326 |
| 97 | Ga0466700_191134 | 3300042600 | Bacteria | 4651 |
| 98 | Ga0466719_483242 | 3300042606 | Bacteria | 2611 |
| 99 | Ga0466692_032419 | 3300042591 | Bacteria | 3507 |
| 100 | Ga0466692_131238 | 3300042591 | Bacteria | 27763 |
| 101 | Ga0466692_174539 | 3300042591 | Bacteria | 2516 |
| 102 | Ga0466696_238146 | 3300042596 | Bacteria | 6557 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF02146 | SIR2 | Sir2 family | 22 | 198 | 0.94 |
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF02146 | GO:0070403 | NAD+ binding | MF |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.