Protein Family IF12039
Metagenome
Isolate
122
Members
49
Samples
114
Scaffolds
160.88
Avg Length
Representative Sequence
- ID
- iso_pr_bacteria|2820306284|2820309171|
- Length
- 159 aa
- Sequence
- MRIGIGYDVHKLVAERLLILGGVTVPFDKGLQGHSDADVLVHAIMDALLGAASLGDIGKFFPDTDDRYKNANSLHLLATVKQALQASNFTVVNIDSIIVAQKPKLADFLPKMAQNISEVLDISTTVVNVKATTEEYLGFTGNGEGIAAHAVCLLENERL
Sample Types
Isolate
6.6%
Metagenome
93.4%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
33.3%
Kalotermitidae
25.0%
Unclassified
20.8%
Rhinotermitidae
8.3%
Termopsidae
8.3%
Passalidae
4.2%
Taxonomy
Archaea
0
Bacteria
121
Eukaryota
0
Viruses
0
Unclassified
1
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 2 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 3 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 4 | 2967483437 | Candidatus Ordinivivax streblomastigis St1 | Isolate | Unclassified |
| 5 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 6 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 7 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 8 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 9 | 2820762746 | Unclassified Bacteroidetes Mp193P4bin3 | Isolate | Unclassified |
| 10 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 11 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 12 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 13 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 14 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 15 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 16 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 17 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 18 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 19 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 20 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 21 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 22 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 23 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 24 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 25 | 2820748953 | Unclassified Bacteroidetes Nt197P4bin17 | Isolate | Unclassified |
| 26 | 3300002508 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 | Metagenome | Termitidae |
| 27 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 28 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 29 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 30 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 31 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 32 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 33 | 2820759988 | Unclassified Bacteroidetes Mp193P4bin4 | Isolate | Unclassified |
| 34 | 2820306284 | Unclassified Firmicutes Th196P1bin11 | Isolate | Unclassified |
| 35 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 36 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 37 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 38 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 39 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 40 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 41 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 42 | 2820781750 | Unclassified Bacteroidetes Emb289P3bin89 | Isolate | Unclassified |
| 43 | 643348524 | Candidatus Azobacteroides pseudotrichonymphae gv. CFP2 | Isolate | Unclassified |
| 44 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 45 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 46 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 47 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 48 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 49 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466715_625525 | 3300042616 | Unclassified | 7456 |
| 2 | Ga0466729_264768 | 3300042621 | Bacteria | 2038 |
| 3 | Ga0466704_307703 | 3300042643 | Bacteria | 10998 |
| 4 | Ga0466709_095978 | 3300042648 | Bacteria | 34809 |
| 5 | Ga0466701_044082 | 3300042598 | Bacteria | 23082 |
| 6 | Ga0466713_107448 | 3300042602 | Bacteria | 14158 |
| 7 | Ga0466717_127655 | 3300042604 | Bacteria | 1068 |
| 8 | Ga0466719_457528 | 3300042606 | Bacteria | 7994 |
| 9 | Ga0466721_043945 | 3300042608 | Bacteria | 11758 |
| 10 | IMNBL1DRAFT_c0000733 | 3300000062 | Bacteria | 26035 |
| 11 | JGI24702J35022_10271695 | 3300002462 | Bacteria | 992 |
| 12 | JGI24700J35501_10930862 | 3300002508 | Bacteria | 29357 |
| 13 | JGI24699J35502_11022660 | 3300002509 | Bacteria | 1461 |
| 14 | Ga0466711_342701 | 3300042615 | Bacteria | 3826 |
| 15 | Ga0466729_285797 | 3300042621 | Bacteria | 17692 |
| 16 | Ga0466735_059852 | 3300042624 | Bacteria | 8124 |
| 17 | Ga0466735_113706 | 3300042624 | Bacteria | 3235 |
| 18 | Ga0466703_371541 | 3300042636 | Bacteria | 1231 |
| 19 | Ga0466704_479589 | 3300042643 | Bacteria | 9853 |
| 20 | Ga0466700_235803 | 3300042600 | Bacteria | 20088 |
| 21 | Ga0466700_416865 | 3300042600 | Bacteria | 2230 |
| 22 | Ga0466707_149202 | 3300042601 | Bacteria | 9070 |
| 23 | Ga0123357_10060824 | 3300009784 | Bacteria | 5065 |
| 24 | Ga0123357_10062643 | 3300009784 | Bacteria | 4977 |
| 25 | Ga0123354_10035956 | 3300010882 | Bacteria | 7731 |
| 26 | JGI24702J35022_10114350 | 3300002462 | Bacteria | 1486 |
| 27 | Ga0068305_10096172 | 3300005083 | Bacteria | 1131 |
| 28 | Ga0466715_583205 | 3300042616 | Bacteria | 24186 |
| 29 | Ga0466723_029668 | 3300042618 | Bacteria | 2374 |
| 30 | Ga0466723_114596 | 3300042618 | Bacteria | 16891 |
| 31 | Ga0466703_152121 | 3300042636 | Bacteria | 1162 |
| 32 | Ga0466704_468893 | 3300042643 | Bacteria | 12102 |
| 33 | Ga0466727_146961 | 3300042655 | Bacteria | 6922 |
| 34 | Ga0466690_279907 | 3300042590 | Bacteria | 12492 |
| 35 | Ga0466690_381813 | 3300042590 | Bacteria | 66142 |
| 36 | Ga0466692_126545 | 3300042591 | Bacteria | 8972 |
| 37 | Ga0466707_151833 | 3300042601 | Bacteria | 2471 |
| 38 | Ga0466722_034359 | 3300042609 | Bacteria | 35656 |
| 39 | Ga0123357_10006254 | 3300009784 | Bacteria | 14468 |
| 40 | Ga0123357_10414504 | 3300009784 | Bacteria | 1210 |
| 41 | Ga0123354_10001986 | 3300010882 | Bacteria | 26232 |
| 42 | 2227393338 | 2225789004 | Bacteria | 1083 |
| 43 | JGI24705J35276_12225752 | 3300002504 | Bacteria | 2763 |
| 44 | JGI24699J35502_11133779 | 3300002509 | Bacteria | 15459 |
| 45 | Ga0466726_032938 | 3300042619 | Bacteria | 39699 |
| 46 | Ga0466735_211515 | 3300042624 | Bacteria | 3083 |
| 47 | Ga0466703_392331 | 3300042636 | Bacteria | 3359 |
| 48 | Ga0466727_124195 | 3300042655 | Bacteria | 107642 |
| 49 | Ga0466690_188170 | 3300042590 | Bacteria | 33248 |
| 50 | Ga0466692_150345 | 3300042591 | Bacteria | 15119 |
| 51 | Ga0466700_286036 | 3300042600 | Bacteria | 14740 |
| 52 | Ga0466719_075471 | 3300042606 | Bacteria | 9184 |
| 53 | Ga0123356_10004478 | 3300010049 | Bacteria | 14432 |
| 54 | JGI24705J35276_12238603 | 3300002504 | Bacteria | 28869 |
| 55 | Ga0123357_10000604 | 3300009784 | Bacteria | 35558 |
| 56 | Ga0466697_136395 | 3300042611 | Bacteria | 1091 |
| 57 | Ga0466735_149441 | 3300042624 | Bacteria | 7846 |
| 58 | Ga0466704_060775 | 3300042643 | Bacteria | 5089 |
| 59 | Ga0456237_0000003 | 3300041968 | Bacteria | 82299 |
| 60 | Ga0466692_100663 | 3300042591 | Bacteria | 44250 |
| 61 | Ga0466692_178326 | 3300042591 | Bacteria | 1111 |
| 62 | Ga0466696_020142 | 3300042596 | Bacteria | 50212 |
| 63 | Ga0466716_411738 | 3300042605 | Bacteria | 3671 |
| 64 | Ga0123357_10004100 | 3300009784 | Bacteria | 16976 |
| 65 | Ga0123356_10074490 | 3300010049 | Bacteria | 3195 |
| 66 | Ga0123354_10033997 | 3300010882 | Bacteria | 7978 |
| 67 | Ga0123354_10102066 | 3300010882 | Bacteria | 3869 |
| 68 | Ga0466734_078676 | 3300042623 | Bacteria | 1045 |
| 69 | Ga0466735_107178 | 3300042624 | Bacteria | 1133 |
| 70 | Ga0466708_095257 | 3300042652 | Bacteria | 18757 |
| 71 | Ga0466692_118997 | 3300042591 | Bacteria | 6541 |
| 72 | Ga0466691_187837 | 3300042593 | Bacteria | 10413 |
| 73 | Ga0466696_114042 | 3300042596 | Bacteria | 8252 |
| 74 | Ga0466696_357148 | 3300042596 | Bacteria | 8974 |
| 75 | Ga0466707_310689 | 3300042601 | Bacteria | 5046 |
| 76 | Ga0466716_154198 | 3300042605 | Bacteria | 13244 |
| 77 | Ga0123357_10027701 | 3300009784 | Bacteria | 7661 |
| 78 | Ga0123357_10489063 | 3300009784 | Bacteria | 1032 |
| 79 | Ga0123357_10675556 | 3300009784 | Bacteria | 752 |
| 80 | Ga0123354_10059564 | 3300010882 | Bacteria | 5660 |
| 81 | IMNBL1DRAFT_c0024995 | 3300000062 | Bacteria | 2299 |
| 82 | JGI24705J35276_12022567 | 3300002504 | Bacteria | 876 |
| 83 | JGI24705J35276_12219054 | 3300002504 | Bacteria | 2182 |
| 84 | JGI24696J40584_12928761 | 3300002834 | Bacteria | 1444 |
| 85 | Ga0072941_1055547 | 3300005201 | Bacteria | 1939 |
| 86 | Ga0466711_246793 | 3300042615 | Bacteria | 3049 |
| 87 | Ga0466729_059466 | 3300042621 | Bacteria | 7565 |
| 88 | Ga0466734_102790 | 3300042623 | Bacteria | 1873 |
| 89 | Ga0466691_184140 | 3300042593 | Bacteria | 4471 |
| 90 | Ga0466694_063253 | 3300042594 | Bacteria | 2894 |
| 91 | Ga0466707_161645 | 3300042601 | Bacteria | 28036 |
| 92 | Ga0466707_271714 | 3300042601 | Bacteria | 3940 |
| 93 | Ga0466716_176616 | 3300042605 | Bacteria | 3271 |
| 94 | Ga0123357_10036470 | 3300009784 | Bacteria | 6691 |
| 95 | Ga0123354_10047429 | 3300010882 | Bacteria | 6547 |
| 96 | JGI24699J35502_11134186 | 3300002509 | Bacteria | 47913 |
| 97 | JGI24696J40584_12784601 | 3300002834 | Bacteria | 842 |
| 98 | Ga0123357_10001873 | 3300009784 | Bacteria | 22846 |
| 99 | Ga0466715_425943 | 3300042616 | Bacteria | 13483 |
| 100 | Ga0466735_173329 | 3300042624 | Bacteria | 3407 |
| 101 | Ga0466735_207537 | 3300042624 | Bacteria | 6563 |
| 102 | Ga0466735_233734 | 3300042624 | Bacteria | 2596 |
| 103 | Ga0466703_319405 | 3300042636 | Bacteria | 3346 |
| 104 | Ga0466692_028860 | 3300042591 | Bacteria | 1637 |
| 105 | Ga0466699_426324 | 3300042597 | Bacteria | 2281 |
| 106 | Ga0466707_328470 | 3300042601 | Bacteria | 9694 |
| 107 | Ga0466713_148442 | 3300042602 | Bacteria | 11365 |
| 108 | Ga0123357_10109792 | 3300009784 | Bacteria | 3523 |
| 109 | Ga0123357_10153166 | 3300009784 | Bacteria | 2790 |
| 110 | Ga0123356_10325134 | 3300010049 | Bacteria | 1652 |
| 111 | Ga0123356_10460426 | 3300010049 | Bacteria | 1421 |
| 112 | Ga0123354_10001302 | 3300010882 | Bacteria | 29724 |
| 113 | JGI24702J35022_10010770 | 3300002462 | Bacteria | 5105 |
| 114 | Ga0068302_10190383 | 3300005071 | Bacteria | 1116 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF02542 | YgbB | YgbB family | 1 | 154 | 0.99 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.