Protein Family IF11988
Metagenome
Isolate
162
Members
43
Samples
151
Scaffolds
130.92
Avg Length
Representative Sequence
- ID
- iso_pr_bacteria|2820234266|2820234310|
- Length
- 143 aa
- Sequence
- MVKSGVAKKMKNRYLLDTHTFLWATGDESVAPKLSYLVRDTIEEPETELLVSAVTLYEITNKHRKGKLPKFGRIAENYMEALTGLDAIELPLTWEHTHLAGSMDLPNKDPFDRMLAAQAITEDLILITCDKAFEGAPGLTTLW
Sample Types
Isolate
6.8%
Metagenome
93.2%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
61.9%
Unclassified
23.8%
Kalotermitidae
9.5%
Hodotermitidae
2.4%
Termopsidae
2.4%
Taxonomy
Archaea
0
Bacteria
141
Eukaryota
0
Viruses
0
Unclassified
21
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820333861 | Unclassified Firmicutes Nt197P3bin72 | Isolate | Unclassified |
| 2 | 2820709481 | Unclassified Firmicutes Co191P1bin30 | Isolate | Unclassified |
| 3 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 4 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 5 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 6 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 7 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 8 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 9 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 10 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 11 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 12 | 2820581541 | Unclassified Firmicutes Emb289P3bin127 | Isolate | Unclassified |
| 13 | 2820671341 | Unclassified Firmicutes Co191P3bin20 | Isolate | Unclassified |
| 14 | 2820702360 | Unclassified Firmicutes Co191P1bin4 | Isolate | Unclassified |
| 15 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 16 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 17 | 2820560510 | Unclassified Firmicutes Emb289P3bin72 | Isolate | Unclassified |
| 18 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 19 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 20 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 21 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 22 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 23 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 24 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 25 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 26 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 27 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 28 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 29 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 30 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 31 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 32 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 33 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 34 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 35 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 36 | 2820234266 | Unclassified Firmicutes Th196P3bin99 | Isolate | Unclassified |
| 37 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 38 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 39 | 2820244222 | Unclassified Firmicutes Th196P3bin75 | Isolate | Unclassified |
| 40 | 2820666966 | Unclassified Firmicutes Co191P3bin39 | Isolate | Unclassified |
| 41 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 42 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 43 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0415639_013639 | 3300038395 | Bacteria | 3297 |
| 2 | Ga0415639_014988 | 3300038395 | Bacteria | 1746 |
| 3 | Ga0415639_178070 | 3300038395 | Bacteria | 3537 |
| 4 | Ga0415639_200549 | 3300038395 | Bacteria | 1653 |
| 5 | Ga0466693_329508 | 3300042592 | Bacteria | 2160 |
| 6 | Ga0466695_316045 | 3300042595 | Bacteria | 1054 |
| 7 | Ga0123355_11132164 | 3300009826 | Bacteria | 809 |
| 8 | Ga0123356_10108706 | 3300010049 | Bacteria | 2674 |
| 9 | Ga0123356_10173467 | 3300010049 | Bacteria | 2170 |
| 10 | Ga0123356_10634706 | 3300010049 | Bacteria | 1234 |
| 11 | Ga0123356_10660727 | 3300010049 | Bacteria | 1213 |
| 12 | Ga0123356_10706280 | 3300010049 | Bacteria | 1177 |
| 13 | Ga0123356_10961603 | 3300010049 | Bacteria | 1025 |
| 14 | Ga0123356_13301211 | 3300010049 | Unclassified | 561 |
| 15 | Ga0123353_10103063 | 3300010167 | Bacteria | 4599 |
| 16 | Ga0123353_11315707 | 3300010167 | Bacteria | 937 |
| 17 | Ga0123354_10270910 | 3300010882 | Bacteria | 1671 |
| 18 | Ga0123354_10366701 | 3300010882 | Bacteria | 1262 |
| 19 | Ga0466706_032201 | 3300042599 | Bacteria | 2421 |
| 20 | Ga0466721_131429 | 3300042608 | Unclassified | 3810 |
| 21 | JGI24695J34938_10068290 | 3300002450 | Bacteria | 1493 |
| 22 | JGI24702J35022_10036953 | 3300002462 | Unclassified | 2609 |
| 23 | Ga0466734_072195 | 3300042623 | Unclassified | 1765 |
| 24 | Ga0466702_322508 | 3300042635 | Bacteria | 1995 |
| 25 | Ga0466704_349811 | 3300042643 | Unclassified | 1053 |
| 26 | Ga0415639_136560 | 3300038395 | Bacteria | 1183 |
| 27 | Ga0415639_203315 | 3300038395 | Bacteria | 1924 |
| 28 | Ga0123355_10049355 | 3300009826 | Bacteria | 6842 |
| 29 | Ga0123355_10797689 | 3300009826 | Bacteria | 1054 |
| 30 | Ga0123356_10810835 | 3300010049 | Bacteria | 1107 |
| 31 | Ga0123353_10688470 | 3300010167 | Bacteria | 1438 |
| 32 | Ga0123353_10767780 | 3300010167 | Unclassified | 1338 |
| 33 | Ga0123353_10927555 | 3300010167 | Unclassified | 1181 |
| 34 | Ga0123353_12469431 | 3300010167 | Bacteria | 619 |
| 35 | Ga0466707_016064 | 3300042601 | Bacteria | 2065 |
| 36 | JGI24702J35022_10369230 | 3300002462 | Bacteria | 861 |
| 37 | JGI24705J35276_12086066 | 3300002504 | Bacteria | 984 |
| 38 | Ga0072940_1017638 | 3300005200 | Bacteria | 10585 |
| 39 | Ga0466715_035522 | 3300042616 | Bacteria | 11927 |
| 40 | Ga0415639_085414 | 3300038395 | Bacteria | 3295 |
| 41 | Ga0415639_133363 | 3300038395 | Bacteria | 2078 |
| 42 | Ga0415639_135083 | 3300038395 | Bacteria | 3380 |
| 43 | Ga0415639_180107 | 3300038395 | Bacteria | 1188 |
| 44 | Ga0466657_398305 | 3300042582 | Bacteria | 1177 |
| 45 | Ga0123355_10765988 | 3300009826 | Bacteria | 1087 |
| 46 | Ga0123355_11508747 | 3300009826 | Bacteria | 655 |
| 47 | Ga0123356_11252789 | 3300010049 | Bacteria | 906 |
| 48 | Ga0123356_11765791 | 3300010049 | Bacteria | 768 |
| 49 | Ga0123353_10163473 | 3300010167 | Unclassified | 3541 |
| 50 | Ga0466707_194330 | 3300042601 | Bacteria | 27303 |
| 51 | Ga0466721_012392 | 3300042608 | Bacteria | 117035 |
| 52 | Ga0466721_405400 | 3300042608 | Bacteria | 2941 |
| 53 | Ga0466697_031818 | 3300042611 | Bacteria | 1080 |
| 54 | JGI24695J34938_10159121 | 3300002450 | Bacteria | 928 |
| 55 | JGI24705J35276_12195684 | 3300002504 | Bacteria | 1529 |
| 56 | JGI24696J40584_12910846 | 3300002834 | Bacteria | 1254 |
| 57 | Ga0072940_1003051 | 3300005200 | Bacteria | 5861 |
| 58 | Ga0466731_341457 | 3300042622 | Bacteria | 1132 |
| 59 | Ga0415639_000537 | 3300038395 | Bacteria | 2191 |
| 60 | Ga0415639_002487 | 3300038395 | Bacteria | 19384 |
| 61 | Ga0415639_066527 | 3300038395 | Bacteria | 3197 |
| 62 | Ga0415639_096390 | 3300038395 | Unclassified | 1046 |
| 63 | Ga0415639_154213 | 3300038395 | Bacteria | 1244 |
| 64 | Ga0415639_247484 | 3300038395 | Bacteria | 1168 |
| 65 | Ga0466693_117304 | 3300042592 | Unclassified | 1543 |
| 66 | Ga0466694_243135 | 3300042594 | Bacteria | 1131 |
| 67 | Ga0123355_10038719 | 3300009826 | Bacteria | 7754 |
| 68 | Ga0123355_10247843 | 3300009826 | Bacteria | 2513 |
| 69 | Ga0123355_10541725 | 3300009826 | Bacteria | 1412 |
| 70 | Ga0123355_10658317 | 3300009826 | Bacteria | 1219 |
| 71 | Ga0123356_10000916 | 3300010049 | Bacteria | 32614 |
| 72 | Ga0123353_10725639 | 3300010167 | Bacteria | 1389 |
| 73 | Ga0123353_10831998 | 3300010167 | Bacteria | 1269 |
| 74 | Ga0466707_049878 | 3300042601 | Bacteria | 1160 |
| 75 | Ga0466714_143028 | 3300042603 | Bacteria | 1166 |
| 76 | JGI24702J35022_10046953 | 3300002462 | Bacteria | 2299 |
| 77 | Ga0466702_134234 | 3300042635 | Bacteria | 2690 |
| 78 | Ga0466723_372801 | 3300042618 | Bacteria | 11551 |
| 79 | Ga0415639_001583 | 3300038395 | Bacteria | 22884 |
| 80 | Ga0415639_007187 | 3300038395 | Bacteria | 65568 |
| 81 | Ga0466693_048899 | 3300042592 | Unclassified | 1243 |
| 82 | Ga0123355_10005083 | 3300009826 | Bacteria | 19168 |
| 83 | Ga0123356_10000039 | 3300010049 | Bacteria | 138853 |
| 84 | Ga0123356_10080911 | 3300010049 | Bacteria | 3072 |
| 85 | Ga0123356_10370609 | 3300010049 | Bacteria | 1562 |
| 86 | Ga0123356_11043610 | 3300010049 | Bacteria | 987 |
| 87 | Ga0123356_12081933 | 3300010049 | Bacteria | 708 |
| 88 | Ga0123353_10619400 | 3300010167 | Bacteria | 1541 |
| 89 | Ga0123353_10803272 | 3300010167 | Bacteria | 1298 |
| 90 | Ga0123353_12269183 | 3300010167 | Bacteria | 654 |
| 91 | Ga0466707_412884 | 3300042601 | Bacteria | 1326 |
| 92 | Ga0466717_052271 | 3300042604 | Bacteria | 1191 |
| 93 | Ga0072940_1388344 | 3300005200 | Bacteria | 1062 |
| 94 | Ga0466705_238416 | 3300042612 | Bacteria | 7790 |
| 95 | Ga0466725_057982 | 3300042654 | Bacteria | 1016 |
| 96 | Ga0466726_329911 | 3300042619 | Bacteria | 12787 |
| 97 | Ga0415639_004522 | 3300038395 | Bacteria | 22477 |
| 98 | Ga0415639_074323 | 3300038395 | Bacteria | 2177 |
| 99 | Ga0123355_10371375 | 3300009826 | Bacteria | 1873 |
| 100 | Ga0123355_10496866 | 3300009826 | Bacteria | 1507 |
| 101 | Ga0123356_10684483 | 3300010049 | Bacteria | 1194 |
| 102 | Ga0123356_11144640 | 3300010049 | Bacteria | 945 |
| 103 | Ga0123353_10014737 | 3300010167 | Bacteria | 11292 |
| 104 | Ga0123353_10331077 | 3300010167 | Bacteria | 2305 |
| 105 | Ga0123353_10489497 | 3300010167 | Unclassified | 1796 |
| 106 | Ga0123353_10605369 | 3300010167 | Bacteria | 1565 |
| 107 | Ga0123353_11039803 | 3300010167 | Bacteria | 1095 |
| 108 | Ga0466707_163757 | 3300042601 | Bacteria | 1805 |
| 109 | Ga0466714_161378 | 3300042603 | Bacteria | 2277 |
| 110 | Ga0466721_064669 | 3300042608 | Bacteria | 1391 |
| 111 | JGI24695J34938_10000194 | 3300002450 | Bacteria | 56974 |
| 112 | Ga0072940_1063478 | 3300005200 | Bacteria | 2936 |
| 113 | Ga0466734_120306 | 3300042623 | Bacteria | 2248 |
| 114 | Ga0466702_339902 | 3300042635 | Bacteria | 1177 |
| 115 | Ga0466718_169063 | 3300042617 | Bacteria | 1525 |
| 116 | Ga0415639_062009 | 3300038395 | Bacteria | 5456 |
| 117 | Ga0123355_10154431 | 3300009826 | Bacteria | 3477 |
| 118 | Ga0123355_10267397 | 3300009826 | Bacteria | 2382 |
| 119 | Ga0123355_10356874 | 3300009826 | Bacteria | 1930 |
| 120 | Ga0123355_11091963 | 3300009826 | Unclassified | 831 |
| 121 | Ga0123356_10000190 | 3300010049 | Bacteria | 70996 |
| 122 | Ga0123356_10053888 | 3300010049 | Bacteria | 3744 |
| 123 | Ga0123356_10171822 | 3300010049 | Bacteria | 2179 |
| 124 | Ga0123356_10473783 | 3300010049 | Bacteria | 1404 |
| 125 | Ga0123356_10502642 | 3300010049 | Bacteria | 1368 |
| 126 | Ga0123356_13586940 | 3300010049 | Bacteria | 537 |
| 127 | Ga0123353_10454165 | 3300010167 | Unclassified | 1885 |
| 128 | Ga0123354_10590450 | 3300010882 | Unclassified | 818 |
| 129 | Ga0466698_444053 | 3300042610 | Unclassified | 2530 |
| 130 | JGI24695J34938_10019097 | 3300002450 | Bacteria | 3406 |
| 131 | Ga0466697_086317 | 3300042611 | Bacteria | 2964 |
| 132 | Ga0415639_022120 | 3300038395 | Bacteria | 12212 |
| 133 | Ga0415639_076061 | 3300038395 | Bacteria | 1777 |
| 134 | Ga0415639_106208 | 3300038395 | Unclassified | 2420 |
| 135 | Ga0415639_166222 | 3300038395 | Bacteria | 1323 |
| 136 | Ga0123355_10163081 | 3300009826 | Bacteria | 3352 |
| 137 | Ga0123355_10842459 | 3300009826 | Bacteria | 1011 |
| 138 | Ga0123355_10870468 | 3300009826 | Bacteria | 986 |
| 139 | Ga0123355_12095816 | 3300009826 | Bacteria | 521 |
| 140 | Ga0123356_10108409 | 3300010049 | Bacteria | 2677 |
| 141 | Ga0123353_10098985 | 3300010167 | Bacteria | 4699 |
| 142 | Ga0123353_10109349 | 3300010167 | Bacteria | 4454 |
| 143 | Ga0123353_10287692 | 3300010167 | Bacteria | 2518 |
| 144 | Ga0123353_10840947 | 3300010167 | Unclassified | 1260 |
| 145 | Ga0123353_13374335 | 3300010167 | Bacteria | 507 |
| 146 | Ga0466706_138629 | 3300042599 | Unclassified | 2179 |
| 147 | Ga0466700_477453 | 3300042600 | Bacteria | 1659 |
| 148 | Ga0466717_114353 | 3300042604 | Bacteria | 1232 |
| 149 | Ga0466717_286248 | 3300042604 | Unclassified | 1703 |
| 150 | Ga0072941_1263952 | 3300005201 | Bacteria | 1406 |
| 151 | Ga0466710_417593 | 3300042613 | Unclassified | 2176 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF01850 | PIN | PIN domain | 14 | 135 | 0.83 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.