Protein Family IF11965
Metagenome
Isolate
118
Members
47
Samples
111
Scaffolds
122.56
Avg Length
Representative Sequence
- ID
- iso_pr_bacteria|2820171952|2820173811|
- Length
- 139 aa
- Sequence
- MASSQESDSVLLNKGYAFAIRVVNMTRYLITEQKEYILAKQVLRSGTAIGALVTESKRAESKPDFIHKLSIALKEADETLYWITLLKDTEVIDEKMYASMSKDTNELIAMLVASIKTAKNNLQKAKSAECQVQGVESKV
Sample Types
Isolate
5.9%
Metagenome
94.1%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
47.8%
Kalotermitidae
17.4%
Unclassified
15.2%
Rhinotermitidae
6.5%
Termopsidae
6.5%
Passalidae
4.3%
Blattidae
2.2%
Taxonomy
Archaea
0
Bacteria
115
Eukaryota
0
Viruses
0
Unclassified
3
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 2 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 3 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 4 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 5 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 6 | 2772190891 | Unclassified Elusimicrobia Emb289P1_bin41 | Isolate | Unclassified |
| 7 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 8 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 9 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 10 | 3300002501 | Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 | Metagenome | Termitidae |
| 11 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 12 | 2754412482 | Unclassified Elusimicrobia Emb289P3bin85 | Isolate | Unclassified |
| 13 | 2820171952 | Unclassified Planctomycetes Th196P3bin88 | Isolate | Unclassified |
| 14 | 2820420508 | Unclassified Firmicutes Lab288P3bin68 | Isolate | Unclassified |
| 15 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 16 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 17 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 18 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 19 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 20 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 21 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 22 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 23 | 2820244222 | Unclassified Firmicutes Th196P3bin75 | Isolate | Unclassified |
| 24 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 25 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 26 | 3004677695 | Bacteroides sp. 214 | Isolate | Blattidae |
| 27 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 28 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 29 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 30 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 31 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 32 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 33 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 34 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 35 | 2820783511 | Unclassified Bacteroidetes Emb289P3bin108 | Isolate | Unclassified |
| 36 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 37 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 38 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 39 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 40 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 41 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 42 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 43 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 44 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 45 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 46 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 47 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466702_053620 | 3300042635 | Bacteria | 1632 |
| 2 | Ga0466698_372497 | 3300042610 | Bacteria | 2628 |
| 3 | Ga0123355_10146885 | 3300009826 | Bacteria | 3593 |
| 4 | Ga0123356_10815352 | 3300010049 | Bacteria | 1104 |
| 5 | Ga0123356_10901998 | 3300010049 | Unclassified | 1055 |
| 6 | Ga0123356_11751224 | 3300010049 | Bacteria | 772 |
| 7 | Ga0123353_11150019 | 3300010167 | Bacteria | 1024 |
| 8 | Ga0123353_12352050 | 3300010167 | Bacteria | 639 |
| 9 | Ga0123354_10817430 | 3300010882 | Unclassified | 625 |
| 10 | 2227455522 | 2225789004 | Bacteria | 1008 |
| 11 | JGI24702J35022_10003233 | 3300002462 | Bacteria | 9856 |
| 12 | JGI24696J40584_12531795 | 3300002834 | Bacteria | 615 |
| 13 | Ga0466731_152859 | 3300042622 | Bacteria | 2110 |
| 14 | Ga0466717_184886 | 3300042604 | Bacteria | 1451 |
| 15 | Ga0123356_10622978 | 3300010049 | Bacteria | 1245 |
| 16 | Ga0123356_10664472 | 3300010049 | Bacteria | 1210 |
| 17 | Ga0123353_10747405 | 3300010167 | Bacteria | 1362 |
| 18 | 2227499661 | 2225789004 | Bacteria | 3833 |
| 19 | 2227654891 | 2225789004 | Bacteria | 1981 |
| 20 | IMNBL1DRAFT_c0105566 | 3300000062 | Bacteria | 753 |
| 21 | JGI24702J35022_10758184 | 3300002462 | Bacteria | 604 |
| 22 | JGI24696J40584_12872588 | 3300002834 | Bacteria | 1051 |
| 23 | JGI24696J40584_12949205 | 3300002834 | Bacteria | 2058 |
| 24 | Ga0466704_345635 | 3300042643 | Bacteria | 8869 |
| 25 | Ga0466700_261399 | 3300042600 | Bacteria | 2850 |
| 26 | Ga0466717_007719 | 3300042604 | Bacteria | 1646 |
| 27 | Ga0123355_11474708 | 3300009826 | Bacteria | 666 |
| 28 | Ga0123355_11928831 | 3300009826 | Bacteria | 551 |
| 29 | Ga0123356_10393164 | 3300010049 | Bacteria | 1522 |
| 30 | Ga0123356_11491508 | 3300010049 | Bacteria | 834 |
| 31 | Ga0123353_10687115 | 3300010167 | Bacteria | 1440 |
| 32 | Ga0466694_073691 | 3300042594 | Bacteria | 1212 |
| 33 | IMNBL1DRAFT_c0051943 | 3300000062 | Bacteria | 1287 |
| 34 | JGI24705J35276_11677797 | 3300002504 | Bacteria | 623 |
| 35 | JGI24705J35276_12236618 | 3300002504 | Bacteria | 8449 |
| 36 | Ga0466697_104336 | 3300042611 | Bacteria | 1220 |
| 37 | Ga0466705_193504 | 3300042612 | Bacteria | 1800 |
| 38 | Ga0466735_172421 | 3300042624 | Bacteria | 1274 |
| 39 | Ga0466703_062414 | 3300042636 | Bacteria | 4559 |
| 40 | Ga0466711_137293 | 3300042615 | Bacteria | 7670 |
| 41 | Ga0466718_064478 | 3300042617 | Bacteria | 3567 |
| 42 | Ga0466728_415562 | 3300042620 | Bacteria | 2819 |
| 43 | Ga0466698_033928 | 3300042610 | Bacteria | 2302 |
| 44 | Ga0466698_503426 | 3300042610 | Bacteria | 1625 |
| 45 | Ga0123355_11781625 | 3300009826 | Bacteria | 582 |
| 46 | Ga0123356_10007920 | 3300010049 | Bacteria | 10576 |
| 47 | Ga0123356_10223918 | 3300010049 | Bacteria | 1939 |
| 48 | Ga0123356_10235481 | 3300010049 | Bacteria | 1898 |
| 49 | Ga0123356_11641394 | 3300010049 | Bacteria | 796 |
| 50 | Ga0123353_11514582 | 3300010167 | Bacteria | 853 |
| 51 | Ga0123353_12019044 | 3300010167 | Bacteria | 706 |
| 52 | Ga0123353_12278794 | 3300010167 | Bacteria | 652 |
| 53 | Ga0466693_413922 | 3300042592 | Bacteria | 3633 |
| 54 | 2227184143 | 2225789004 | Bacteria | 1485 |
| 55 | JGI24703J35330_11624775 | 3300002501 | Bacteria | 1468 |
| 56 | JGI24696J40584_12596802 | 3300002834 | Bacteria | 654 |
| 57 | Ga0068305_10106067 | 3300005083 | Bacteria | 2459 |
| 58 | Ga0466734_105660 | 3300042623 | Bacteria | 2072 |
| 59 | Ga0466725_108655 | 3300042654 | Bacteria | 45004 |
| 60 | Ga0466711_172850 | 3300042615 | Bacteria | 2141 |
| 61 | Ga0466715_282391 | 3300042616 | Bacteria | 1846 |
| 62 | Ga0466701_043628 | 3300042598 | Bacteria | 1478 |
| 63 | Ga0123356_10764132 | 3300010049 | Bacteria | 1137 |
| 64 | Ga0123356_11692937 | 3300010049 | Bacteria | 784 |
| 65 | Ga0123353_10046505 | 3300010167 | Bacteria | 6897 |
| 66 | Ga0123353_11824805 | 3300010167 | Bacteria | 754 |
| 67 | Ga0466690_167861 | 3300042590 | Bacteria | 27742 |
| 68 | Ga0068302_10099691 | 3300005071 | Bacteria | 948 |
| 69 | Ga0466703_249864 | 3300042636 | Bacteria | 1905 |
| 70 | Ga0466717_157510 | 3300042604 | Bacteria | 1215 |
| 71 | Ga0466721_254723 | 3300042608 | Bacteria | 1012 |
| 72 | Ga0123356_10001110 | 3300010049 | Bacteria | 29837 |
| 73 | Ga0123356_10073672 | 3300010049 | Bacteria | 3211 |
| 74 | Ga0123356_10786398 | 3300010049 | Bacteria | 1122 |
| 75 | Ga0123356_12129037 | 3300010049 | Unclassified | 701 |
| 76 | Ga0123356_12363281 | 3300010049 | Bacteria | 665 |
| 77 | Ga0123353_10209407 | 3300010167 | Bacteria | 3059 |
| 78 | Ga0123353_10564327 | 3300010167 | Bacteria | 1638 |
| 79 | Ga0466692_119732 | 3300042591 | Bacteria | 19858 |
| 80 | JGI24702J35022_10148579 | 3300002462 | Bacteria | 1313 |
| 81 | JGI24705J35276_11716821 | 3300002504 | Bacteria | 641 |
| 82 | JGI24696J40584_12723672 | 3300002834 | Bacteria | 762 |
| 83 | Ga0072941_1055620 | 3300005201 | Bacteria | 2103 |
| 84 | Ga0466729_221454 | 3300042621 | Bacteria | 46517 |
| 85 | Ga0466731_105269 | 3300042622 | Bacteria | 1491 |
| 86 | Ga0466702_048480 | 3300042635 | Bacteria | 1031 |
| 87 | Ga0466715_032527 | 3300042616 | Bacteria | 1418 |
| 88 | Ga0466726_343827 | 3300042619 | Bacteria | 1635 |
| 89 | Ga0466722_239344 | 3300042609 | Bacteria | 3235 |
| 90 | Ga0466698_265121 | 3300042610 | Bacteria | 2656 |
| 91 | Ga0123357_10175002 | 3300009784 | Bacteria | 2526 |
| 92 | Ga0123356_10023735 | 3300010049 | Bacteria | 5771 |
| 93 | Ga0123356_11417418 | 3300010049 | Bacteria | 855 |
| 94 | Ga0123353_10188553 | 3300010167 | Bacteria | 3258 |
| 95 | Ga0123354_10007147 | 3300010882 | Bacteria | 16726 |
| 96 | Ga0123354_10163773 | 3300010882 | Bacteria | 2625 |
| 97 | Ga0123354_10304172 | 3300010882 | Bacteria | 1502 |
| 98 | Ga0466690_218964 | 3300042590 | Bacteria | 1405 |
| 99 | Ga0466703_162953 | 3300042636 | Bacteria | 3549 |
| 100 | Ga0466718_038113 | 3300042617 | Bacteria | 1771 |
| 101 | Ga0466719_061459 | 3300042606 | Bacteria | 8605 |
| 102 | Ga0123357_10736933 | 3300009784 | Bacteria | 691 |
| 103 | Ga0123355_10457564 | 3300009826 | Bacteria | 1604 |
| 104 | Ga0123356_10399233 | 3300010049 | Bacteria | 1512 |
| 105 | Ga0123353_10003749 | 3300010167 | Bacteria | 19343 |
| 106 | Ga0123353_10734128 | 3300010167 | Bacteria | 1378 |
| 107 | Ga0123353_11288219 | 3300010167 | Bacteria | 950 |
| 108 | Ga0123353_11706850 | 3300010167 | Bacteria | 788 |
| 109 | Ga0123354_10014306 | 3300010882 | Bacteria | 12354 |
| 110 | JGI24702J35022_10101371 | 3300002462 | Bacteria | 1577 |
| 111 | JGI24696J40584_12766815 | 3300002834 | Bacteria | 815 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF05635 | 23S_rRNA_IVP | 23S rRNA-intervening sequence protein | 11 | 112 | 0.96 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.