Protein Family IF11849
Metagenome
Isolate
165
Members
46
Samples
156
Scaffolds
802.31
Avg Length
Representative Sequence
- ID
- iso_pr_bacteria|2781125695|2781437960|
- Length
- 939 aa
- Sequence
- MVIAIDGPAGSGKSTIAKLLAQKLHDAEGKGFDYINSGKLYRAIALGCLRTGIDPADNESVITFARDASIQYQNDRLVLNGEDVTEKLHTDEIDLFSAPLSAIVPVRHIVNDIIRNIAKGENVVVEGRDMTSVVFPNAEHRFFLDASVETRAMRRFGQGVSQLGLDEIKTTITQRDEIDRNKIEGSLVISEKVVYIDTSDLTINQVYDILEEKIKWGNQNRGKKMDNLEVVADTSPLDNSPAGNSLAGKGSYGTNQLNLQSPDISESDALKKNTPNAGLADETADSASVKNANSFPGESKDEENIQTQLQEEYLKTLEQLEEGQLVVGVVVQVNEDHVFIDVGYKSEGKIPISAFAQTPKIGDSVPVVLIAKENKRGEVIVSKQKADEKITWKNIKSAHQDNSVVEGTIEKAIKGGFEVNLGSGIKAFLPIRQADVLKIDSPEKLVGEKTFFHVERVYSEGKINIIVNRRKYLEEEFERKRKEFFDTIPIGTDVNGIVKSFTSFGAFIDLGGFDGLLHINDMSWGHVTRPKEFVRKGQEIRLKVIRIDRAEKRINLSLKHFTDDPWVHFEDKYHVNDIVKGKVTKLTEFGAFIEIEEGIEGLAHISEFSWVKKIQKPQEFVKPNDVVECMILGYDLQAGRVSLGLKQVTANPWDDIENRYPLGLRLSRTVVKITNAGAFINLEEGIDGFLHGDDISWTKKIKHPGSELSVGQEIEVMVISLDKENRNIRLGIKQLTDNPWQSFSESYHHGSQVEGEVASVTDFGIFVRVPGGIEGLIHKTNLIENRNDNPDDALKKFKVGDKIRAVVLEVQGDKQKLAFSIKDYQKKMQREELSRYMTEEEDGASTFTLGDIXKSKNNAAEEQSALNTDKDTQQNSEVPDAEGSKAGEEPADMHPADNNPIENQADNPEDSHVENTPDKQPVDFQSEETQPEDSSPESS
Sample Types
Isolate
5.5%
Metagenome
94.5%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
37.8%
Kalotermitidae
31.1%
Unclassified
22.2%
Rhinotermitidae
4.4%
Termopsidae
2.2%
Hodotermitidae
2.2%
Taxonomy
Archaea
0
Bacteria
161
Eukaryota
0
Viruses
0
Unclassified
4
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820016619 | Unclassified Spirochaetes Nt197P3bin71 | Isolate | Unclassified |
| 2 | 2781125686 | Treponema sp. Lab288P4bin22 | Isolate | Unclassified |
| 3 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 4 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 5 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 6 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 7 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 8 | 2781125682 | Treponema sp. Lab288P1bin107 | Isolate | Unclassified |
| 9 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 10 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 11 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 12 | 2781125658 | Treponema sp. Emb289P3bin37 | Isolate | Unclassified |
| 13 | 2781125690 | Treponema sp. Th196P3bin63 | Isolate | Unclassified |
| 14 | 2781125695 | Treponema sp. Th196P4bin30 | Isolate | Unclassified |
| 15 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 16 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 17 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 18 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 19 | 2781125687 | Treponema sp. Lab288P4bin29 | Isolate | Unclassified |
| 20 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 21 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 22 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 23 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 24 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 25 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 26 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 27 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 28 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 29 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 30 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 31 | 2819994798 | Unclassified Spirochaetes Th196P1bin3 | Isolate | Unclassified |
| 32 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 33 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 34 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 35 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 36 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 37 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 38 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 39 | 2781125633 | Treponema sp. Co191P1bin38 | Isolate | Unclassified |
| 40 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 41 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 42 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 43 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 44 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 45 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 46 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_015293 | 3300042612 | Bacteria | 20878 |
| 2 | Ga0466705_162123 | 3300042612 | Bacteria | 8295 |
| 3 | Ga0466690_072934 | 3300042590 | Bacteria | 14264 |
| 4 | Ga0466706_207839 | 3300042599 | Bacteria | 7638 |
| 5 | Ga0466719_141499 | 3300042606 | Bacteria | 48503 |
| 6 | Ga0466720_156846 | 3300042607 | Bacteria | 86259 |
| 7 | Ga0466721_137114 | 3300042608 | Bacteria | 43430 |
| 8 | Ga0466722_013053 | 3300042609 | Bacteria | 15524 |
| 9 | Ga0466704_495134 | 3300042643 | Bacteria | 48700 |
| 10 | Ga0466708_064422 | 3300042652 | Bacteria | 47318 |
| 11 | Ga0466712_008465 | 3300042614 | Bacteria | 10621 |
| 12 | Ga0466712_298873 | 3300042614 | Bacteria | 12241 |
| 13 | Ga0466715_051723 | 3300042616 | Bacteria | 23274 |
| 14 | Ga0466723_101229 | 3300042618 | Bacteria | 13955 |
| 15 | Ga0466705_091160 | 3300042612 | Bacteria | 7851 |
| 16 | Ga0466705_281182 | 3300042612 | Bacteria | 4283 |
| 17 | Ga0466690_048663 | 3300042590 | Bacteria | 11095 |
| 18 | Ga0466690_240917 | 3300042590 | Bacteria | 13473 |
| 19 | Ga0466691_040280 | 3300042593 | Bacteria | 50816 |
| 20 | Ga0466699_076425 | 3300042597 | Bacteria | 21448 |
| 21 | Ga0466716_140116 | 3300042605 | Bacteria | 14119 |
| 22 | Ga0466720_099821 | 3300042607 | Bacteria | 83537 |
| 23 | Ga0466703_081386 | 3300042636 | Bacteria | 31630 |
| 24 | Ga0466703_293153 | 3300042636 | Bacteria | 14467 |
| 25 | Ga0466704_147894 | 3300042643 | Bacteria | 10113 |
| 26 | Ga0466704_266541 | 3300042643 | Bacteria | 32514 |
| 27 | Ga0466704_440467 | 3300042643 | Bacteria | 11523 |
| 28 | Ga0466704_570199 | 3300042643 | Bacteria | 12828 |
| 29 | Ga0466709_403643 | 3300042648 | Bacteria | 15968 |
| 30 | JGI24698J34947_10012515 | 3300002449 | Bacteria | 4649 |
| 31 | Ga0466723_048411 | 3300042618 | Bacteria | 6855 |
| 32 | Ga0466726_103660 | 3300042619 | Bacteria | 15823 |
| 33 | Ga0466726_104003 | 3300042619 | Bacteria | 8639 |
| 34 | Ga0466726_130430 | 3300042619 | Bacteria | 11919 |
| 35 | Ga0466726_189992 | 3300042619 | Bacteria | 49531 |
| 36 | Ga0466728_127377 | 3300042620 | Bacteria | 3120 |
| 37 | Ga0466705_018142 | 3300042612 | Unclassified | 10666 |
| 38 | Ga0466705_027941 | 3300042612 | Bacteria | 5941 |
| 39 | Ga0264413_106755 | 3300024493 | Bacteria | 25715 |
| 40 | Ga0466696_053753 | 3300042596 | Bacteria | 23190 |
| 41 | Ga0466696_178214 | 3300042596 | Bacteria | 7433 |
| 42 | Ga0466699_089262 | 3300042597 | Bacteria | 27561 |
| 43 | Ga0466722_126248 | 3300042609 | Bacteria | 4738 |
| 44 | Ga0466709_172940 | 3300042648 | Bacteria | 6127 |
| 45 | Ga0466708_138698 | 3300042652 | Bacteria | 2155 |
| 46 | JGI24698J34947_10004178 | 3300002449 | Bacteria | 7847 |
| 47 | JGI24695J34938_10010925 | 3300002450 | Bacteria | 4930 |
| 48 | Ga0466711_504467 | 3300042615 | Bacteria | 25230 |
| 49 | Ga0466715_419773 | 3300042616 | Bacteria | 10459 |
| 50 | Ga0466723_123393 | 3300042618 | Bacteria | 21773 |
| 51 | Ga0466723_134571 | 3300042618 | Bacteria | 37387 |
| 52 | Ga0466726_149859 | 3300042619 | Bacteria | 7852 |
| 53 | Ga0466732_084887 | 3300042656 | Bacteria | 9304 |
| 54 | Ga0466733_188879 | 3300042659 | Bacteria | 16600 |
| 55 | Ga0466694_102765 | 3300042594 | Bacteria | 18692 |
| 56 | Ga0466699_010488 | 3300042597 | Bacteria | 10326 |
| 57 | Ga0466699_043337 | 3300042597 | Unclassified | 19509 |
| 58 | Ga0466719_104615 | 3300042606 | Bacteria | 13046 |
| 59 | Ga0466720_034297 | 3300042607 | Bacteria | 26071 |
| 60 | Ga0466720_114099 | 3300042607 | Bacteria | 44632 |
| 61 | Ga0466722_176545 | 3300042609 | Bacteria | 11203 |
| 62 | Ga0466703_184110 | 3300042636 | Bacteria | 17468 |
| 63 | Ga0466709_215478 | 3300042648 | Bacteria | 19677 |
| 64 | Ga0466708_288506 | 3300042652 | Bacteria | 17766 |
| 65 | JGI24698J34947_10002544 | 3300002449 | Bacteria | 9840 |
| 66 | JGI24695J34938_10001541 | 3300002450 | Bacteria | 19418 |
| 67 | JGI24702J35022_10003367 | 3300002462 | Bacteria | 9660 |
| 68 | Ga0068305_10017261 | 3300005083 | Bacteria | 18339 |
| 69 | Ga0466711_011902 | 3300042615 | Bacteria | 8117 |
| 70 | Ga0466711_107728 | 3300042615 | Bacteria | 9042 |
| 71 | Ga0466711_424059 | 3300042615 | Bacteria | 6683 |
| 72 | Ga0466726_200973 | 3300042619 | Bacteria | 13994 |
| 73 | Ga0123353_10141072 | 3300010167 | Bacteria | 3860 |
| 74 | Ga0466691_202726 | 3300042593 | Bacteria | 11524 |
| 75 | Ga0466691_222002 | 3300042593 | Bacteria | 16050 |
| 76 | Ga0466694_053998 | 3300042594 | Bacteria | 22359 |
| 77 | Ga0466716_263448 | 3300042605 | Bacteria | 10485 |
| 78 | Ga0466719_365881 | 3300042606 | Bacteria | 27169 |
| 79 | Ga0466722_175249 | 3300042609 | Bacteria | 63620 |
| 80 | Ga0466703_046056 | 3300042636 | Bacteria | 73078 |
| 81 | Ga0466703_052378 | 3300042636 | Bacteria | 9197 |
| 82 | Ga0466703_404885 | 3300042636 | Bacteria | 3496 |
| 83 | Ga0466709_195575 | 3300042648 | Bacteria | 43370 |
| 84 | JGI24698J34947_10002711 | 3300002449 | Bacteria | 9565 |
| 85 | JGI24698J34947_10005244 | 3300002449 | Bacteria | 7111 |
| 86 | JGI24695J34938_10009341 | 3300002450 | Unclassified | 5460 |
| 87 | Ga0466705_483888 | 3300042612 | Bacteria | 4305 |
| 88 | Ga0466712_046625 | 3300042614 | Bacteria | 8991 |
| 89 | Ga0466711_172875 | 3300042615 | Bacteria | 9490 |
| 90 | Ga0466726_026746 | 3300042619 | Bacteria | 13331 |
| 91 | Ga0466726_054689 | 3300042619 | Bacteria | 6939 |
| 92 | Ga0466728_082151 | 3300042620 | Bacteria | 22320 |
| 93 | Ga0466705_078397 | 3300042612 | Bacteria | 9275 |
| 94 | Ga0466692_075206 | 3300042591 | Bacteria | 8997 |
| 95 | Ga0466691_184069 | 3300042593 | Bacteria | 5338 |
| 96 | Ga0466699_181043 | 3300042597 | Bacteria | 7010 |
| 97 | Ga0466722_022288 | 3300042609 | Bacteria | 20823 |
| 98 | JGI24698J34947_10010349 | 3300002449 | Bacteria | 5115 |
| 99 | Ga0466711_354889 | 3300042615 | Bacteria | 35161 |
| 100 | Ga0466711_373146 | 3300042615 | Bacteria | 8238 |
| 101 | Ga0466726_118348 | 3300042619 | Bacteria | 4202 |
| 102 | Ga0466705_183474 | 3300042612 | Bacteria | 93595 |
| 103 | Ga0466705_213716 | 3300042612 | Bacteria | 8249 |
| 104 | Ga0466705_220240 | 3300042612 | Bacteria | 7731 |
| 105 | Ga0466732_235512 | 3300042656 | Bacteria | 8682 |
| 106 | Ga0123356_10001933 | 3300010049 | Bacteria | 22428 |
| 107 | Ga0466693_182738 | 3300042592 | Bacteria | 29264 |
| 108 | Ga0466699_171808 | 3300042597 | Bacteria | 7731 |
| 109 | Ga0466719_102691 | 3300042606 | Bacteria | 22550 |
| 110 | Ga0466704_105260 | 3300042643 | Bacteria | 45472 |
| 111 | Ga0466704_470046 | 3300042643 | Bacteria | 7561 |
| 112 | Ga0466708_098923 | 3300042652 | Bacteria | 5410 |
| 113 | Ga0466708_135402 | 3300042652 | Bacteria | 8442 |
| 114 | Ga0466708_235833 | 3300042652 | Bacteria | 24736 |
| 115 | JGI24698J34947_10003940 | 3300002449 | Bacteria | 8072 |
| 116 | JGI24696J40584_12960052 | 3300002834 | Bacteria | 6192 |
| 117 | Ga0068305_10017959 | 3300005083 | Bacteria | 9399 |
| 118 | Ga0466711_186535 | 3300042615 | Bacteria | 4226 |
| 119 | Ga0466715_132799 | 3300042616 | Bacteria | 20317 |
| 120 | Ga0466715_420362 | 3300042616 | Bacteria | 36991 |
| 121 | Ga0466715_428670 | 3300042616 | Bacteria | 32474 |
| 122 | Ga0466715_511031 | 3300042616 | Bacteria | 17662 |
| 123 | Ga0466718_010368 | 3300042617 | Bacteria | 37109 |
| 124 | Ga0466718_086776 | 3300042617 | Bacteria | 73105 |
| 125 | Ga0466723_048331 | 3300042618 | Bacteria | 25354 |
| 126 | Ga0466728_066942 | 3300042620 | Bacteria | 22999 |
| 127 | Ga0466728_154650 | 3300042620 | Bacteria | 24366 |
| 128 | Ga0466728_238773 | 3300042620 | Bacteria | 5819 |
| 129 | Ga0466705_049995 | 3300042612 | Bacteria | 25525 |
| 130 | Ga0466705_232109 | 3300042612 | Bacteria | 13291 |
| 131 | Ga0123355_10006185 | 3300009826 | Bacteria | 17680 |
| 132 | Ga0123354_10034170 | 3300010882 | Bacteria | 7951 |
| 133 | Ga0466690_001088 | 3300042590 | Bacteria | 2125 |
| 134 | Ga0466692_176309 | 3300042591 | Bacteria | 4861 |
| 135 | Ga0466691_004271 | 3300042593 | Bacteria | 8625 |
| 136 | Ga0466694_301329 | 3300042594 | Bacteria | 6015 |
| 137 | Ga0466699_006774 | 3300042597 | Bacteria | 22044 |
| 138 | Ga0466720_233314 | 3300042607 | Bacteria | 12092 |
| 139 | Ga0466722_035847 | 3300042609 | Bacteria | 10338 |
| 140 | Ga0466704_070677 | 3300042643 | Bacteria | 16242 |
| 141 | Ga0466704_154976 | 3300042643 | Bacteria | 32964 |
| 142 | Ga0466709_016920 | 3300042648 | Bacteria | 17380 |
| 143 | Ga0466708_264829 | 3300042652 | Bacteria | 3776 |
| 144 | Ga0466708_320973 | 3300042652 | Bacteria | 9674 |
| 145 | Ga0466708_397974 | 3300042652 | Bacteria | 25866 |
| 146 | JGI24695J34938_10024446 | 3300002450 | Bacteria | 2901 |
| 147 | Ga0466705_403670 | 3300042612 | Unclassified | 13382 |
| 148 | Ga0466712_021785 | 3300042614 | Bacteria | 7884 |
| 149 | Ga0466712_313598 | 3300042614 | Bacteria | 19352 |
| 150 | Ga0466715_081158 | 3300042616 | Bacteria | 4319 |
| 151 | Ga0466715_304351 | 3300042616 | Bacteria | 6676 |
| 152 | Ga0466715_552925 | 3300042616 | Bacteria | 6469 |
| 153 | Ga0466723_040574 | 3300042618 | Bacteria | 12285 |
| 154 | Ga0466723_050256 | 3300042618 | Bacteria | 7351 |
| 155 | Ga0466728_041627 | 3300042620 | Bacteria | 18579 |
| 156 | Ga0466728_333868 | 3300042620 | Bacteria | 8162 |
MSA Aligner
Functional Annotation
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF00575 | GO:0003676 | nucleic acid binding | MF |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.