Protein Family IF11837
Metagenome
Isolate
149
Members
46
Samples
143
Scaffolds
82.41
Avg Length
Representative Sequence
- ID
- iso_pr_bacteria|2781125692|2781430987|
- Length
- 94 aa
- Sequence
- MMSILLYLSIVMCKDDVYAAVKKLLMDKFGLQEDMISPDKLLEDELDFDSLDAVDLLIYLENHIEGKPESSIFRNVKTVQDVVDILYPLWKNEA
Sample Types
Isolate
4.0%
Metagenome
96.0%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
46.5%
Kalotermitidae
20.9%
Unclassified
18.6%
Termopsidae
7.0%
Rhinotermitidae
4.7%
Hodotermitidae
2.3%
Taxonomy
Archaea
0
Bacteria
136
Eukaryota
0
Viruses
0
Unclassified
13
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 2 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 3 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 4 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 5 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 6 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 7 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 8 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 9 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 10 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 11 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 12 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 13 | 2781125692 | Treponema sp. Th196P3bin31 | Isolate | Unclassified |
| 14 | 2819990093 | Unclassified Spirochaetes Cu122P1bin9 | Isolate | Unclassified |
| 15 | 3300005485 | Termite gut microbial communities from Costa Rica - P3 luminal contents | Metagenome | Termitidae |
| 16 | 2781125630 | Treponema sp. Nt197P3bin60 | Isolate | Unclassified |
| 17 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 18 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 19 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 20 | 2820134530 | Unclassified Proteobacteria Emb289P3bin65 | Isolate | Unclassified |
| 21 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 22 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 23 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 24 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 25 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 26 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 27 | 2030936001 | Nasutitermes corniger hindgut microbial communities from Florida, USA | Metagenome | Termitidae |
| 28 | 2819992462 | Unclassified Spirochaetes Nc150P4bin14 | Isolate | Unclassified |
| 29 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 30 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 31 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 32 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 33 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 34 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 35 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 36 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 37 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 38 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 39 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 40 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 41 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 42 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 43 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 44 | 2820020240 | Unclassified Spirochaetes Nc150P3bin10 | Isolate | Unclassified |
| 45 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 46 | 3300001880 | Termite hindgut microbial communities from the Max Planck Institute, Bremen, Germany, analyzing fibers in the hindgut lumen - ASSEMBLED Fiber-Associated Metagenome | Metagenome |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466732_177296 | 3300042656 | Bacteria | 2648 |
| 2 | Ga0466732_262374 | 3300042656 | Bacteria | 16043 |
| 3 | Ga0466732_292101 | 3300042656 | Bacteria | 1824 |
| 4 | Ga0466718_125754 | 3300042617 | Bacteria | 3399 |
| 5 | Ga0264413_118134 | 3300024493 | Bacteria | 5050 |
| 6 | Ga0466709_349890 | 3300042648 | Bacteria | 1998 |
| 7 | Ga0466707_048949 | 3300042601 | Bacteria | 1144 |
| 8 | Ga0466707_372341 | 3300042601 | Bacteria | 1457 |
| 9 | Ga0466719_119883 | 3300042606 | Bacteria | 32227 |
| 10 | Ga0466720_040642 | 3300042607 | Bacteria | 7524 |
| 11 | Ga0466720_051968 | 3300042607 | Bacteria | 35380 |
| 12 | Ga0466720_072686 | 3300042607 | Bacteria | 20088 |
| 13 | Ga0466720_138447 | 3300042607 | Bacteria | 2558 |
| 14 | Nasutiter_Contig15472 | 2030936001 | Bacteria | 502 |
| 15 | AustNasuHG_c1001691 | 3300000089 | Bacteria | 7967 |
| 16 | AustNasuHG_c1024649 | 3300000089 | Bacteria | 1902 |
| 17 | FAAS_10340050 | 3300001880 | Bacteria | 615 |
| 18 | FAAS_10673681 | 3300001880 | Bacteria | 580 |
| 19 | JGI24702J35022_10198460 | 3300002462 | Bacteria | 1147 |
| 20 | Ga0466732_236748 | 3300042656 | Bacteria | 8790 |
| 21 | Ga0123353_10198812 | 3300010167 | Bacteria | 3156 |
| 22 | Ga0466718_008586 | 3300042617 | Bacteria | 9677 |
| 23 | Ga0466718_023427 | 3300042617 | Bacteria | 12924 |
| 24 | Ga0466718_076527 | 3300042617 | Bacteria | 2008 |
| 25 | Ga0466718_096052 | 3300042617 | Bacteria | 1026 |
| 26 | Ga0466718_100257 | 3300042617 | Bacteria | 18237 |
| 27 | Ga0466718_150315 | 3300042617 | Bacteria | 9710 |
| 28 | Ga0264413_124817 | 3300024493 | Unclassified | 2125 |
| 29 | Ga0264413_140934 | 3300024493 | Bacteria | 1133 |
| 30 | Ga0466694_045110 | 3300042594 | Bacteria | 2414 |
| 31 | Ga0466704_204916 | 3300042643 | Bacteria | 1514 |
| 32 | Ga0466709_339137 | 3300042648 | Bacteria | 15454 |
| 33 | Ga0466717_210503 | 3300042604 | Bacteria | 2109 |
| 34 | Ga0466716_093157 | 3300042605 | Bacteria | 36386 |
| 35 | Ga0466719_392636 | 3300042606 | Bacteria | 1299 |
| 36 | Ga0466720_027944 | 3300042607 | Unclassified | 5290 |
| 37 | Ga0466698_032932 | 3300042610 | Bacteria | 1096 |
| 38 | AustNasuHG_c1004450 | 3300000089 | Bacteria | 5023 |
| 39 | AustNasuHG_c1024011 | 3300000089 | Bacteria | 1938 |
| 40 | AustNasuHG_c1024327 | 3300000089 | Bacteria | 1920 |
| 41 | AustNasuHG_c1074103 | 3300000089 | Bacteria | 600 |
| 42 | JGI24695J34938_10007363 | 3300002450 | Bacteria | 6454 |
| 43 | Ga0072941_1022677 | 3300005201 | Bacteria | 18258 |
| 44 | Ga0074263_141629 | 3300005485 | Bacteria | 788 |
| 45 | Ga0466718_021939 | 3300042617 | Bacteria | 2261 |
| 46 | Ga0466718_088518 | 3300042617 | Bacteria | 10423 |
| 47 | Ga0466718_122256 | 3300042617 | Bacteria | 26403 |
| 48 | Ga0466691_063132 | 3300042593 | Bacteria | 13644 |
| 49 | Ga0466696_270025 | 3300042596 | Unclassified | 1656 |
| 50 | Ga0466706_179332 | 3300042599 | Unclassified | 1136 |
| 51 | Ga0466713_093051 | 3300042602 | Bacteria | 6833 |
| 52 | Ga0466717_149847 | 3300042604 | Bacteria | 1110 |
| 53 | Ga0466720_165736 | 3300042607 | Bacteria | 6870 |
| 54 | Ga0466720_213041 | 3300042607 | Bacteria | 2185 |
| 55 | Ga0466698_107671 | 3300042610 | Bacteria | 2015 |
| 56 | Ga0466705_194468 | 3300042612 | Bacteria | 25394 |
| 57 | Ga0123356_10534903 | 3300010049 | Bacteria | 1331 |
| 58 | Ga0123356_12404205 | 3300010049 | Bacteria | 659 |
| 59 | Ga0466715_254094 | 3300042616 | Bacteria | 18771 |
| 60 | Ga0466718_028853 | 3300042617 | Unclassified | 2656 |
| 61 | Ga0466718_092885 | 3300042617 | Bacteria | 6134 |
| 62 | Ga0466729_127627 | 3300042621 | Bacteria | 1182 |
| 63 | Ga0264413_117414 | 3300024493 | Bacteria | 1087 |
| 64 | Ga0264413_121764 | 3300024493 | Bacteria | 2479 |
| 65 | Ga0466704_049432 | 3300042643 | Bacteria | 1802 |
| 66 | Ga0466720_070459 | 3300042607 | Bacteria | 9574 |
| 67 | Ga0466720_217425 | 3300042607 | Bacteria | 21579 |
| 68 | AustNasuHG_c1000619 | 3300000089 | Bacteria | 12570 |
| 69 | AustNasuHG_c1000765 | 3300000089 | Bacteria | 11444 |
| 70 | AustNasuHG_c1003122 | 3300000089 | Bacteria | 5973 |
| 71 | AustNasuHG_c1016910 | 3300000089 | Bacteria | 2434 |
| 72 | JGI24698J34947_10188718 | 3300002449 | Bacteria | 817 |
| 73 | Ga0466732_320499 | 3300042656 | Bacteria | 1060 |
| 74 | Ga0466715_503150 | 3300042616 | Bacteria | 2228 |
| 75 | Ga0466718_038059 | 3300042617 | Bacteria | 14472 |
| 76 | Ga0466718_098678 | 3300042617 | Bacteria | 2873 |
| 77 | Ga0264413_141604 | 3300024493 | Bacteria | 1513 |
| 78 | Ga0466707_065240 | 3300042601 | Bacteria | 2550 |
| 79 | AustNasuHG_c1020808 | 3300000089 | Bacteria | 2132 |
| 80 | FAAS_10297014 | 3300001880 | Unclassified | 559 |
| 81 | JGI24698J34947_10060315 | 3300002449 | Bacteria | 1872 |
| 82 | JGI24705J35276_12220086 | 3300002504 | Bacteria | 2244 |
| 83 | Ga0072940_1033097 | 3300005200 | Bacteria | 2425 |
| 84 | Ga0072940_1111573 | 3300005200 | Unclassified | 802 |
| 85 | Ga0072941_1000456 | 3300005201 | Bacteria | 20789 |
| 86 | Ga0072941_1325384 | 3300005201 | Bacteria | 660 |
| 87 | Ga0074263_131512 | 3300005485 | Unclassified | 833 |
| 88 | Ga0123356_11159382 | 3300010049 | Bacteria | 940 |
| 89 | Ga0466712_266351 | 3300042614 | Bacteria | 2066 |
| 90 | Ga0466718_005222 | 3300042617 | Bacteria | 8367 |
| 91 | Ga0264413_131730 | 3300024493 | Bacteria | 1171 |
| 92 | Ga0264413_145429 | 3300024493 | Bacteria | 3903 |
| 93 | Ga0466695_101625 | 3300042595 | Unclassified | 5793 |
| 94 | Ga0466727_161892 | 3300042655 | Bacteria | 1020 |
| 95 | Ga0466700_118877 | 3300042600 | Bacteria | 1077 |
| 96 | Ga0466700_450911 | 3300042600 | Bacteria | 1010 |
| 97 | Ga0466720_045068 | 3300042607 | Unclassified | 4347 |
| 98 | Ga0466720_102668 | 3300042607 | Bacteria | 5497 |
| 99 | Ga0466720_128458 | 3300042607 | Bacteria | 29477 |
| 100 | Ga0466720_149293 | 3300042607 | Bacteria | 43020 |
| 101 | Ga0466720_238860 | 3300042607 | Bacteria | 102895 |
| 102 | AustNasuHG_c1000146 | 3300000089 | Bacteria | 22298 |
| 103 | JGI24698J34947_10124781 | 3300002449 | Bacteria | 1111 |
| 104 | Ga0072940_1004782 | 3300005200 | Bacteria | 999 |
| 105 | Ga0072941_1278405 | 3300005201 | Bacteria | 2466 |
| 106 | Ga0074263_117356 | 3300005485 | Bacteria | 2694 |
| 107 | Ga0466732_368313 | 3300042656 | Bacteria | 6284 |
| 108 | Ga0466718_027705 | 3300042617 | Bacteria | 21984 |
| 109 | Ga0466718_091199 | 3300042617 | Bacteria | 4679 |
| 110 | Ga0466718_166483 | 3300042617 | Bacteria | 4599 |
| 111 | Ga0415639_156335 | 3300038395 | Bacteria | 1439 |
| 112 | Ga0466692_024793 | 3300042591 | Bacteria | 12426 |
| 113 | Ga0466691_206393 | 3300042593 | Bacteria | 20362 |
| 114 | Ga0466708_246011 | 3300042652 | Bacteria | 47079 |
| 115 | Ga0466706_106808 | 3300042599 | Bacteria | 1298 |
| 116 | Ga0466720_022958 | 3300042607 | Bacteria | 5494 |
| 117 | Ga0466720_228907 | 3300042607 | Unclassified | 1546 |
| 118 | AustNasuHG_c1007134 | 3300000089 | Bacteria | 3982 |
| 119 | AustNasuHG_c1018814 | 3300000089 | Bacteria | 2273 |
| 120 | JGI24698J34947_10207409 | 3300002449 | Bacteria | 762 |
| 121 | Ga0072940_1066091 | 3300005200 | Bacteria | 1294 |
| 122 | Ga0074263_129515 | 3300005485 | Bacteria | 870 |
| 123 | Ga0466732_341646 | 3300042656 | Bacteria | 2625 |
| 124 | Ga0123356_10013787 | 3300010049 | Bacteria | 7784 |
| 125 | Ga0123353_10078122 | 3300010167 | Bacteria | 5319 |
| 126 | Ga0466718_016063 | 3300042617 | Bacteria | 36821 |
| 127 | Ga0466718_160855 | 3300042617 | Unclassified | 1903 |
| 128 | Ga0466726_299538 | 3300042619 | Bacteria | 2652 |
| 129 | Ga0264413_101697 | 3300024493 | Bacteria | 51877 |
| 130 | Ga0466692_000624 | 3300042591 | Bacteria | 3251 |
| 131 | Ga0466735_006661 | 3300042624 | Bacteria | 12528 |
| 132 | Ga0466719_285275 | 3300042606 | Bacteria | 4555 |
| 133 | Ga0466720_002785 | 3300042607 | Bacteria | 44479 |
| 134 | Ga0466720_003238 | 3300042607 | Bacteria | 32291 |
| 135 | Ga0466720_025415 | 3300042607 | Bacteria | 22188 |
| 136 | Ga0466720_105231 | 3300042607 | Bacteria | 17684 |
| 137 | Ga0466698_372570 | 3300042610 | Bacteria | 1302 |
| 138 | AustNasuHG_c1052450 | 3300000089 | Bacteria | 858 |
| 139 | FAAS_10434924 | 3300001880 | Bacteria | 556 |
| 140 | JGI24698J34947_10009676 | 3300002449 | Bacteria | 5283 |
| 141 | JGI24698J34947_10242742 | 3300002449 | Unclassified | 677 |
| 142 | Ga0072940_1004784 | 3300005200 | Bacteria | 2435 |
| 143 | Ga0072940_1211173 | 3300005200 | Bacteria | 633 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00550 | PP-binding | Phosphopantetheine attachment site | 20 | 85 | 0.94 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.