Protein Family IF11818
Metagenome
Isolate
143
Members
42
Samples
131
Scaffolds
136.9
Avg Length
Representative Sequence
- ID
- iso_pr_bacteria|2781125683|2781410966|
- Length
- 133 aa
- Sequence
- MAEQTNSPLEWRLLAERDLSVAEHLAATMRPLPTEVVAFFCQQTAEKYLKGALVILGVEPPRAFLDELCALPEKKRPAFASVSTQCSVISHFSVQPRYDLGLSLSEDDMKTVIAHAKSIRDFLKAETPELFAE
Sample Types
Isolate
8.4%
Metagenome
91.6%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
60.0%
Unclassified
27.5%
Termopsidae
7.5%
Hodotermitidae
2.5%
Rhinotermitidae
2.5%
Taxonomy
Archaea
0
Bacteria
123
Eukaryota
0
Viruses
0
Unclassified
20
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2781125661 | Treponema sp. Emb289P3bin69 | Isolate | Unclassified |
| 2 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 3 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 4 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 5 | 2781125664 | Treponema sp. Emb289P3bin139 | Isolate | Unclassified |
| 6 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 7 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 8 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 9 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 10 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 11 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 12 | 2781125635 | Treponema sp. Co191P1bin60 | Isolate | Unclassified |
| 13 | 2781125689 | Treponema sp. Mp193P4bin9 | Isolate | Unclassified |
| 14 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 15 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 16 | 2781125641 | Treponema sp. Co191P1bin27 | Isolate | Unclassified |
| 17 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 18 | 2781125645 | Treponema sp. Co191P3bin32 | Isolate | Unclassified |
| 19 | 2781125656 | Treponema sp. Emb289P1bin65 | Isolate | Unclassified |
| 20 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 21 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 22 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 23 | 2781125683 | Treponema sp. Lab288P1bin34 | Isolate | Unclassified |
| 24 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 25 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 26 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 27 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 28 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 29 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 30 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 31 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 32 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 33 | 2781125657 | Treponema sp. Emb289P3bin15 | Isolate | Unclassified |
| 34 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 35 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 36 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 37 | 2781125658 | Treponema sp. Emb289P3bin37 | Isolate | Unclassified |
| 38 | 2781125681 | Treponema sp. Lab288P1bin11 | Isolate | Unclassified |
| 39 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 40 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 41 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 42 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | AustNasuHG_c1085459 | 3300000089 | Bacteria | 520 |
| 2 | JGI24698J34947_10000519 | 3300002449 | Bacteria | 18161 |
| 3 | JGI24698J34947_10240264 | 3300002449 | Bacteria | 683 |
| 4 | JGI24695J34938_10021924 | 3300002450 | Bacteria | 3113 |
| 5 | Ga0072941_1002940 | 3300005201 | Bacteria | 4903 |
| 6 | Ga0072941_1489754 | 3300005201 | Bacteria | 888 |
| 7 | Ga0466717_058770 | 3300042604 | Bacteria | 1116 |
| 8 | Ga0466720_170891 | 3300042607 | Bacteria | 2387 |
| 9 | Ga0466721_121063 | 3300042608 | Bacteria | 2251 |
| 10 | Ga0466698_295151 | 3300042610 | Bacteria | 1614 |
| 11 | Ga0466712_194073 | 3300042614 | Bacteria | 10983 |
| 12 | Ga0466726_244972 | 3300042619 | Bacteria | 4653 |
| 13 | Ga0415639_020579 | 3300038395 | Unclassified | 2257 |
| 14 | Ga0466699_102328 | 3300042597 | Bacteria | 4369 |
| 15 | Ga0466699_363571 | 3300042597 | Bacteria | 1022 |
| 16 | Ga0123355_11436078 | 3300009826 | Unclassified | 679 |
| 17 | Ga0123356_10000045 | 3300010049 | Bacteria | 131000 |
| 18 | Ga0123356_10352763 | 3300010049 | Bacteria | 1595 |
| 19 | Ga0123356_10812845 | 3300010049 | Bacteria | 1106 |
| 20 | Ga0466732_425891 | 3300042656 | Bacteria | 1125 |
| 21 | JGI24698J34947_10184137 | 3300002449 | Bacteria | 832 |
| 22 | JGI24698J34947_10209458 | 3300002449 | Unclassified | 757 |
| 23 | JGI24695J34938_10000281 | 3300002450 | Bacteria | 50109 |
| 24 | JGI24695J34938_10453125 | 3300002450 | Unclassified | 580 |
| 25 | Ga0466712_127632 | 3300042614 | Bacteria | 1002 |
| 26 | Ga0466712_266439 | 3300042614 | Bacteria | 1157 |
| 27 | Ga0466718_001369 | 3300042617 | Bacteria | 5460 |
| 28 | Ga0415639_146576 | 3300038395 | Bacteria | 2731 |
| 29 | Ga0415639_165024 | 3300038395 | Bacteria | 1525 |
| 30 | Ga0466695_297040 | 3300042595 | Bacteria | 1092 |
| 31 | Ga0123356_10009290 | 3300010049 | Bacteria | 9712 |
| 32 | Ga0123356_12537095 | 3300010049 | Bacteria | 642 |
| 33 | Ga0123353_10869808 | 3300010167 | Bacteria | 1232 |
| 34 | AustNasuHG_c1025809 | 3300000089 | Bacteria | 1841 |
| 35 | JGI24698J34947_10005387 | 3300002449 | Bacteria | 7021 |
| 36 | JGI24698J34947_10036048 | 3300002449 | Unclassified | 2577 |
| 37 | JGI24695J34938_10073293 | 3300002450 | Unclassified | 1426 |
| 38 | JGI24695J34938_10112338 | 3300002450 | Bacteria | 1110 |
| 39 | Ga0072940_1102367 | 3300005200 | Bacteria | 1013 |
| 40 | Ga0072941_1028887 | 3300005201 | Bacteria | 19122 |
| 41 | Ga0072941_1180700 | 3300005201 | Unclassified | 1087 |
| 42 | Ga0466712_005718 | 3300042614 | Bacteria | 27508 |
| 43 | Ga0466726_311217 | 3300042619 | Bacteria | 1094 |
| 44 | Ga0466694_112934 | 3300042594 | Bacteria | 2648 |
| 45 | Ga0123355_10360200 | 3300009826 | Bacteria | 1917 |
| 46 | Ga0123356_11051711 | 3300010049 | Bacteria | 983 |
| 47 | Ga0123353_11461869 | 3300010167 | Bacteria | 874 |
| 48 | Ga0123354_10947784 | 3300010882 | Unclassified | 559 |
| 49 | AustNasuHG_c1019774 | 3300000089 | Bacteria | 2204 |
| 50 | JGI24698J34947_10015969 | 3300002449 | Bacteria | 4083 |
| 51 | JGI24698J34947_10061704 | 3300002449 | Bacteria | 1844 |
| 52 | JGI24698J34947_10126250 | 3300002449 | Bacteria | 1102 |
| 53 | JGI24698J34947_10177300 | 3300002449 | Unclassified | 856 |
| 54 | JGI24695J34938_10028660 | 3300002450 | Bacteria | 2613 |
| 55 | Ga0072941_1019044 | 3300005201 | Bacteria | 10348 |
| 56 | Ga0466717_245165 | 3300042604 | Bacteria | 1918 |
| 57 | Ga0466712_021339 | 3300042614 | Bacteria | 10259 |
| 58 | Ga0466712_159714 | 3300042614 | Bacteria | 1556 |
| 59 | Ga0466712_304371 | 3300042614 | Bacteria | 12622 |
| 60 | Ga0466693_342068 | 3300042592 | Bacteria | 7818 |
| 61 | Ga0466694_061626 | 3300042594 | Bacteria | 24990 |
| 62 | Ga0123356_10113651 | 3300010049 | Bacteria | 2620 |
| 63 | JGI24698J34947_10168688 | 3300002449 | Bacteria | 888 |
| 64 | JGI24698J34947_10174456 | 3300002449 | Bacteria | 866 |
| 65 | JGI24695J34938_10356212 | 3300002450 | Bacteria | 644 |
| 66 | Ga0068302_10588790 | 3300005071 | Bacteria | 569 |
| 67 | Ga0072940_1031079 | 3300005200 | Bacteria | 533 |
| 68 | Ga0072941_1065446 | 3300005201 | Bacteria | 7439 |
| 69 | Ga0466718_043758 | 3300042617 | Bacteria | 11678 |
| 70 | Ga0264413_123537 | 3300024493 | Bacteria | 1096 |
| 71 | Ga0466693_250041 | 3300042592 | Bacteria | 1597 |
| 72 | Ga0466699_013828 | 3300042597 | Bacteria | 4866 |
| 73 | Ga0123355_10084106 | 3300009826 | Bacteria | 5069 |
| 74 | Ga0123356_10014338 | 3300010049 | Bacteria | 7624 |
| 75 | Ga0123356_10064699 | 3300010049 | Bacteria | 3420 |
| 76 | Ga0123356_10151643 | 3300010049 | Bacteria | 2302 |
| 77 | Ga0123356_10274634 | 3300010049 | Bacteria | 1777 |
| 78 | Ga0123356_10807613 | 3300010049 | Bacteria | 1109 |
| 79 | Ga0123356_11415718 | 3300010049 | Bacteria | 855 |
| 80 | Ga0123354_10790493 | 3300010882 | Bacteria | 641 |
| 81 | AustNasuHG_c1051388 | 3300000089 | Bacteria | 877 |
| 82 | JGI24698J34947_10010220 | 3300002449 | Bacteria | 5146 |
| 83 | JGI24698J34947_10081361 | 3300002449 | Bacteria | 1518 |
| 84 | JGI24698J34947_10274021 | 3300002449 | Unclassified | 620 |
| 85 | JGI24695J34938_10126026 | 3300002450 | Bacteria | 1043 |
| 86 | JGI24695J34938_10563704 | 3300002450 | Bacteria | 527 |
| 87 | JGI24699J35502_11133580 | 3300002509 | Bacteria | 12141 |
| 88 | Ga0466712_039195 | 3300042614 | Bacteria | 13921 |
| 89 | Ga0466712_087140 | 3300042614 | Bacteria | 10029 |
| 90 | Ga0466712_107269 | 3300042614 | Bacteria | 1892 |
| 91 | Ga0466712_133886 | 3300042614 | Bacteria | 8061 |
| 92 | Ga0466718_114235 | 3300042617 | Unclassified | 2842 |
| 93 | Ga0466699_365735 | 3300042597 | Bacteria | 1473 |
| 94 | Ga0123356_10001116 | 3300010049 | Bacteria | 29729 |
| 95 | Ga0123356_10001799 | 3300010049 | Bacteria | 23355 |
| 96 | Ga0123356_10685495 | 3300010049 | Bacteria | 1193 |
| 97 | Ga0123356_12291274 | 3300010049 | Unclassified | 675 |
| 98 | AustNasuHG_c1012248 | 3300000089 | Bacteria | 2962 |
| 99 | AustNasuHG_c1046632 | 3300000089 | Bacteria | 976 |
| 100 | JGI24698J34947_10106443 | 3300002449 | Unclassified | 1247 |
| 101 | JGI24698J34947_10133552 | 3300002449 | Unclassified | 1057 |
| 102 | JGI24698J34947_10177063 | 3300002449 | Unclassified | 857 |
| 103 | JGI24695J34938_10003536 | 3300002450 | Bacteria | 10820 |
| 104 | JGI24695J34938_10039846 | 3300002450 | Unclassified | 2119 |
| 105 | JGI24695J34938_10312296 | 3300002450 | Bacteria | 682 |
| 106 | JGI24695J34938_10618050 | 3300002450 | Bacteria | 506 |
| 107 | Ga0072940_1007727 | 3300005200 | Bacteria | 4334 |
| 108 | Ga0072940_1024051 | 3300005200 | Bacteria | 7003 |
| 109 | Ga0466706_238048 | 3300042599 | Bacteria | 1017 |
| 110 | Ga0466734_073315 | 3300042623 | Bacteria | 2151 |
| 111 | Ga0466727_210605 | 3300042655 | Bacteria | 1309 |
| 112 | Ga0466712_123099 | 3300042614 | Unclassified | 2873 |
| 113 | Ga0466712_181370 | 3300042614 | Bacteria | 13093 |
| 114 | Ga0466718_139814 | 3300042617 | Unclassified | 3034 |
| 115 | Ga0415639_004768 | 3300038395 | Bacteria | 1992 |
| 116 | Ga0123353_11884010 | 3300010167 | Bacteria | 739 |
| 117 | AustNasuHG_c1005110 | 3300000089 | Bacteria | 4690 |
| 118 | JGI24698J34947_10015605 | 3300002449 | Bacteria | 4135 |
| 119 | JGI24698J34947_10183767 | 3300002449 | Bacteria | 833 |
| 120 | JGI24695J34938_10000071 | 3300002450 | Bacteria | 85834 |
| 121 | JGI24695J34938_10021754 | 3300002450 | Unclassified | 3129 |
| 122 | JGI24695J34938_10181658 | 3300002450 | Bacteria | 871 |
| 123 | Ga0072941_1057314 | 3300005201 | Bacteria | 3758 |
| 124 | Ga0466722_057104 | 3300042609 | Bacteria | 1629 |
| 125 | Ga0466731_071441 | 3300042622 | Bacteria | 1374 |
| 126 | Ga0466694_405772 | 3300042594 | Bacteria | 3477 |
| 127 | Ga0123357_10132015 | 3300009784 | Bacteria | 3105 |
| 128 | Ga0123355_10013106 | 3300009826 | Bacteria | 12877 |
| 129 | Ga0123355_10945960 | 3300009826 | Unclassified | 926 |
| 130 | Ga0123356_10238599 | 3300010049 | Bacteria | 1887 |
| 131 | Ga0123353_10204968 | 3300010167 | Bacteria | 3099 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300010049 | Ga0123356_12537095 | Ga0123356_125370952 | 119 |
| 2 | 3300002449 | JGI24698J34947_10010220 | JGI24698J34947_100102203 | 121 |
| 3 | 3300005071 | Ga0068302_10588790 | Ga0068302_105887901 | 124 |
| 4 | 3300000089 | AustNasuHG_c1019774 | AustNasuHG_10197742 | 126 |
| 5 | 3300002449 | JGI24698J34947_10015605 | JGI24698J34947_100156054 | 130 |
| 6 | 3300002450 | JGI24695J34938_10073293 | JGI24695J34938_100732933 | 131 |
| 7 | 3300010882 | Ga0123354_10947784 | Ga0123354_109477842 | 132 |
| 8 | 3300000089 | AustNasuHG_c1046632 | AustNasuHG_10466322 | 133 |
| 9 | 3300009826 | Ga0123355_10945960 | Ga0123355_109459601 | 133 |
| 10 | 3300009826 | Ga0123355_11436078 | Ga0123355_114360781 | 133 |
| 11 | 3300010049 | Ga0123356_10113651 | Ga0123356_101136512 | 133 |
| 12 | 3300024493 | Ga0264413_123537 | Ga0264413_1235371 | 133 |
| 13 | 3300042604 | Ga0466717_245165 | Ga0466717_245165_1111_1512 | 133 |
| 14 | 3300042607 | Ga0466720_170891 | Ga0466720_170891_674_1075 | 133 |
| 15 | 3300042617 | Ga0466718_001369 | Ga0466718_001369_854_1255 | 133 |
| 16 | 3300042617 | Ga0466718_043758 | Ga0466718_043758_5817_6218 | 133 |
| 17 | 3300042623 | Ga0466734_073315 | Ga0466734_073315_1137_1538 | 133 |
| 18 | 3300042656 | Ga0466732_425891 | Ga0466732_425891_653_1054 | 133 |
| 19 | iso_pr_bacteria | 2781125683 | 2781410966 | 133 |
| 20 | 3300000089 | AustNasuHG_c1005110 | AustNasuHG_10051104 | 134 |
| 21 | 3300000089 | AustNasuHG_c1025809 | AustNasuHG_10258093 | 134 |
| 22 | 3300002449 | JGI24698J34947_10274021 | JGI24698J34947_102740211 | 134 |
| 23 | 3300002450 | JGI24695J34938_10126026 | JGI24695J34938_101260261 | 134 |
| 24 | 3300005200 | Ga0072940_1007727 | Ga0072940_10077275 | 134 |
| 25 | 3300005200 | Ga0072940_1024051 | Ga0072940_102405110 | 134 |
| 26 | 3300005200 | Ga0072940_1031079 | Ga0072940_10310791 | 134 |
| 27 | 3300005200 | Ga0072940_1102367 | Ga0072940_11023672 | 134 |
| 28 | 3300009784 | Ga0123357_10132015 | Ga0123357_101320156 | 134 |
| 29 | 3300010882 | Ga0123354_10790493 | Ga0123354_107904931 | 134 |
| 30 | 3300042594 | Ga0466694_061626 | Ga0466694_061626_8873_9277 | 134 |
| 31 | 3300042594 | Ga0466694_405772 | Ga0466694_405772_2380_2784 | 134 |
| 32 | 3300042595 | Ga0466695_297040 | Ga0466695_297040_391_795 | 134 |
| 33 | 3300042609 | Ga0466722_057104 | Ga0466722_057104_1134_1538 | 134 |
| 34 | 3300042614 | Ga0466712_005718 | Ga0466712_005718_278_682 | 134 |
| 35 | 3300042614 | Ga0466712_123099 | Ga0466712_123099_2224_2628 | 134 |
| 36 | 3300042617 | Ga0466718_114235 | Ga0466718_114235_1068_1472 | 134 |
| 37 | 3300042617 | Ga0466718_139814 | Ga0466718_139814_1803_2207 | 134 |
| 38 | iso_pr_bacteria | 2781125641 | 2781291393 | 134 |
| 39 | iso_pr_bacteria | 2781125681 | 2781408274 | 134 |
| 40 | 3300002449 | JGI24698J34947_10005387 | JGI24698J34947_100053873 | 135 |
| 41 | 3300002449 | JGI24698J34947_10036048 | JGI24698J34947_100360481 | 135 |
| 42 | 3300002449 | JGI24698J34947_10174456 | JGI24698J34947_101744561 | 135 |
| 43 | 3300002449 | JGI24698J34947_10177063 | JGI24698J34947_101770632 | 135 |
| 44 | 3300002449 | JGI24698J34947_10177300 | JGI24698J34947_101773002 | 135 |
| 45 | 3300002449 | JGI24698J34947_10183767 | JGI24698J34947_101837672 | 135 |
| 46 | 3300002449 | JGI24698J34947_10240264 | JGI24698J34947_102402641 | 135 |
| 47 | 3300002450 | JGI24695J34938_10000071 | JGI24695J34938_1000007115 | 135 |
| 48 | 3300002450 | JGI24695J34938_10003536 | JGI24695J34938_100035363 | 135 |
| 49 | 3300002450 | JGI24695J34938_10021754 | JGI24695J34938_100217542 | 135 |
| 50 | 3300002450 | JGI24695J34938_10181658 | JGI24695J34938_101816581 | 135 |
| 51 | 3300002450 | JGI24695J34938_10618050 | JGI24695J34938_106180501 | 135 |
| 52 | 3300005201 | Ga0072941_1019044 | Ga0072941_101904413 | 135 |
| 53 | 3300005201 | Ga0072941_1057314 | Ga0072941_10573142 | 135 |
| 54 | 3300005201 | Ga0072941_1489754 | Ga0072941_14897542 | 135 |
| 55 | 3300009826 | Ga0123355_10084106 | Ga0123355_100841063 | 135 |
| 56 | 3300038395 | Ga0415639_004768 | Ga0415639_004768_874_1281 | 135 |
| 57 | 3300042597 | Ga0466699_013828 | Ga0466699_013828_417_824 | 135 |
| 58 | 3300042597 | Ga0466699_102328 | Ga0466699_102328_2028_2435 | 135 |
| 59 | 3300042597 | Ga0466699_365735 | Ga0466699_365735_933_1340 | 135 |
| 60 | 3300042614 | Ga0466712_194073 | Ga0466712_194073_8965_9372 | 135 |
| 61 | 3300042619 | Ga0466726_244972 | Ga0466726_244972_3528_3935 | 135 |
| 62 | 3300042619 | Ga0466726_311217 | Ga0466726_311217_70_477 | 135 |
| 63 | 3300042655 | Ga0466727_210605 | Ga0466727_210605_364_771 | 135 |
| 64 | 3300000089 | AustNasuHG_c1012248 | AustNasuHG_10122483 | 136 |
| 65 | 3300000089 | AustNasuHG_c1051388 | AustNasuHG_10513881 | 136 |
| 66 | 3300000089 | AustNasuHG_c1085459 | AustNasuHG_10854591 | 136 |
| 67 | 3300002449 | JGI24698J34947_10061704 | JGI24698J34947_100617042 | 136 |
| 68 | 3300002450 | JGI24695J34938_10028660 | JGI24695J34938_100286602 | 136 |
| 69 | 3300005201 | Ga0072941_1065446 | Ga0072941_10654464 | 136 |
| 70 | 3300010049 | Ga0123356_10014338 | Ga0123356_100143382 | 136 |
| 71 | 3300010049 | Ga0123356_10812845 | Ga0123356_108128453 | 136 |
| 72 | 3300042597 | Ga0466699_363571 | Ga0466699_363571_431_841 | 136 |
| 73 | 3300042604 | Ga0466717_058770 | Ga0466717_058770_409_819 | 136 |
| 74 | 3300042614 | Ga0466712_159714 | Ga0466712_159714_508_918 | 136 |
| 75 | iso_pr_bacteria | 2781125689 | 2781426697 | 136 |
| 76 | 3300002449 | JGI24698J34947_10000519 | JGI24698J34947_100005199 | 137 |
| 77 | 3300002449 | JGI24698J34947_10081361 | JGI24698J34947_100813612 | 137 |
| 78 | 3300002449 | JGI24698J34947_10126250 | JGI24698J34947_101262501 | 137 |
| 79 | 3300002449 | JGI24698J34947_10168688 | JGI24698J34947_101686882 | 137 |
| 80 | 3300002449 | JGI24698J34947_10209458 | JGI24698J34947_102094582 | 137 |
| 81 | 3300002450 | JGI24695J34938_10312296 | JGI24695J34938_103122961 | 137 |
| 82 | 3300002509 | JGI24699J35502_11133580 | JGI24699J35502_111335808 | 137 |
| 83 | 3300005201 | Ga0072941_1002940 | Ga0072941_10029404 | 137 |
| 84 | 3300005201 | Ga0072941_1028887 | Ga0072941_102888719 | 137 |
| 85 | 3300010049 | Ga0123356_12291274 | Ga0123356_122912742 | 137 |
| 86 | 3300042592 | Ga0466693_342068 | Ga0466693_342068_3478_3891 | 137 |
| 87 | 3300042608 | Ga0466721_121063 | Ga0466721_121063_1530_1943 | 137 |
| 88 | 3300042614 | Ga0466712_087140 | Ga0466712_087140_5557_5970 | 137 |
| 89 | 3300042614 | Ga0466712_127632 | Ga0466712_127632_213_626 | 137 |
| 90 | 3300042614 | Ga0466712_133886 | Ga0466712_133886_4148_4561 | 137 |
| 91 | 3300042614 | Ga0466712_266439 | Ga0466712_266439_674_1087 | 137 |
| 92 | 3300042614 | Ga0466712_304371 | Ga0466712_304371_3335_3748 | 137 |
| 93 | iso_pr_bacteria | 2781125664 | 2781340814 | 137 |
| 94 | 3300002449 | JGI24698J34947_10015969 | JGI24698J34947_100159692 | 138 |
| 95 | 3300002449 | JGI24698J34947_10106443 | JGI24698J34947_101064432 | 138 |
| 96 | 3300002449 | JGI24698J34947_10133552 | JGI24698J34947_101335523 | 138 |
| 97 | 3300002449 | JGI24698J34947_10184137 | JGI24698J34947_101841372 | 138 |
| 98 | 3300002450 | JGI24695J34938_10021924 | JGI24695J34938_100219242 | 138 |
| 99 | 3300010049 | Ga0123356_10807613 | Ga0123356_108076132 | 138 |
| 100 | 3300010049 | Ga0123356_11415718 | Ga0123356_114157182 | 138 |
| 101 | 3300042594 | Ga0466694_112934 | Ga0466694_112934_1432_1848 | 138 |
| 102 | 3300042614 | Ga0466712_021339 | Ga0466712_021339_3006_3422 | 138 |
| 103 | 3300042614 | Ga0466712_039195 | Ga0466712_039195_864_1280 | 138 |
| 104 | 3300042614 | Ga0466712_181370 | Ga0466712_181370_7904_8320 | 138 |
| 105 | iso_pr_bacteria | 2781125635 | 2781279308 | 138 |
| 106 | iso_pr_bacteria | 2781125656 | 2781320251 | 138 |
| 107 | 3300005201 | Ga0072941_1180700 | Ga0072941_11807002 | 139 |
| 108 | 3300009826 | Ga0123355_10013106 | Ga0123355_1001310611 | 139 |
| 109 | 3300010167 | Ga0123353_10204968 | Ga0123353_102049685 | 139 |
| 110 | 3300010167 | Ga0123353_10869808 | Ga0123353_108698081 | 139 |
| 111 | 3300010167 | Ga0123353_11461869 | Ga0123353_114618692 | 139 |
| 112 | 3300042592 | Ga0466693_250041 | Ga0466693_250041_617_1036 | 139 |
| 113 | 3300042622 | Ga0466731_071441 | Ga0466731_071441_220_639 | 139 |
| 114 | iso_pr_bacteria | 2781125657 | 2781322658 | 139 |
| 115 | 3300010049 | Ga0123356_10000045 | Ga0123356_10000045121 | 140 |
| 116 | 3300010049 | Ga0123356_10238599 | Ga0123356_102385994 | 140 |
| 117 | 3300010167 | Ga0123353_11884010 | Ga0123353_118840101 | 140 |
| 118 | 3300038395 | Ga0415639_146576 | Ga0415639_146576_229_651 | 140 |
| 119 | 3300038395 | Ga0415639_165024 | Ga0415639_165024_60_482 | 140 |
| 120 | 3300009826 | Ga0123355_10360200 | Ga0123355_103602002 | 141 |
| 121 | 3300010049 | Ga0123356_10151643 | Ga0123356_101516432 | 141 |
| 122 | 3300038395 | Ga0415639_020579 | Ga0415639_020579_212_637 | 141 |
| 123 | 3300010049 | Ga0123356_10274634 | Ga0123356_102746343 | 142 |
| 124 | 3300042599 | Ga0466706_238048 | Ga0466706_238048_361_789 | 142 |
| 125 | 3300042610 | Ga0466698_295151 | Ga0466698_295151_164_592 | 142 |
| 126 | 3300002450 | JGI24695J34938_10039846 | JGI24695J34938_100398462 | 143 |
| 127 | 3300002450 | JGI24695J34938_10112338 | JGI24695J34938_101123382 | 143 |
| 128 | 3300002450 | JGI24695J34938_10356212 | JGI24695J34938_103562122 | 143 |
| 129 | 3300002450 | JGI24695J34938_10563704 | JGI24695J34938_105637041 | 143 |
| 130 | 3300010049 | Ga0123356_10064699 | Ga0123356_100646992 | 143 |
| 131 | 3300042614 | Ga0466712_107269 | Ga0466712_107269_1436_1867 | 143 |
| 132 | iso_pr_bacteria | 2781125661 | 2781333378 | 143 |
| 133 | 3300010049 | Ga0123356_10001116 | Ga0123356_100011162 | 144 |
| 134 | 3300010049 | Ga0123356_10352763 | Ga0123356_103527633 | 144 |
| 135 | iso_pr_bacteria | 2781125635 | 2781278040 | 146 |
| 136 | iso_pr_bacteria | 2781125645 | 2781298696 | 146 |
| 137 | 3300002450 | JGI24695J34938_10000281 | JGI24695J34938_1000028120 | 147 |
| 138 | 3300010049 | Ga0123356_10685495 | Ga0123356_106854952 | 147 |
| 139 | 3300002450 | JGI24695J34938_10453125 | JGI24695J34938_104531251 | 148 |
| 140 | 3300010049 | Ga0123356_10001799 | Ga0123356_100017997 | 148 |
| 141 | 3300010049 | Ga0123356_11051711 | Ga0123356_110517112 | 149 |
| 142 | iso_pr_bacteria | 2781125658 | 2781326347 | 152 |
| 143 | 3300010049 | Ga0123356_10009290 | Ga0123356_100092904 | 153 |
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF05168 | HEPN | HEPN domain | 10 | 124 | 0.94 |
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.85 | 0.85 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.