Protein Family IF11800
Metagenome
Isolate
135
Members
61
Samples
122
Scaffolds
357.51
Avg Length
Representative Sequence
- ID
- iso_pr_bacteria|2781125661|2781333385|
- Length
- 390 aa
- Sequence
- MALFAKNPNESAYAGGKKHWSDVIKNSGSGDLLIWRQPEEDFNTQSTLIVMPGEEAIFIKGGVIEQTFDNGTYKLSTENYPFISRLRNAFTGGISTFNCVVYFVRKAHSMEILWGTSSPIQVRDKLLGIATKLRARGSYKIQVDNPQKFLTKLIGNNINIIDQQELLDDYFANEFQSKIKSNITRALNETQTELLGIEARLEEFAETVEPFFADVFNDYGLKMVKFSIAALDLDDDELRRRYDEIGMDAIAKMRNAQADRGVMDVLGNDWGRQQAANILGTLAQNPGSGGVAAAGAGLGMGMAAGGIFGGMAQQMFSPMQQQAQPPTAPQPSGRFTQKSAQTGGMNTTPAAEGNADDPLASLKKLKEMLDLGLIEQAEFDTKKAEIMSRM
Sample Types
Isolate
9.6%
Metagenome
90.4%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
45.9%
Unclassified
23.0%
Kalotermitidae
18.0%
Rhinotermitidae
4.9%
Termopsidae
3.3%
Hodotermitidae
1.6%
Blattidae
1.6%
Passalidae
1.6%
Taxonomy
Archaea
2
Bacteria
128
Eukaryota
0
Viruses
0
Unclassified
5
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820721785 | Unclassified Fibrobacteres Lab288P1bin58 | Isolate | Unclassified |
| 2 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 3 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 4 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 5 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 6 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 7 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 8 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 9 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 10 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 11 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 12 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 13 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 14 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 15 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 16 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 17 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 18 | 3300002508 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 | Metagenome | Termitidae |
| 19 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 20 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 21 | 2920168565 | Paludibacter sp. 221 | Isolate | Blattidae |
| 22 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 23 | 2820693137 | Unclassified Firmicutes Co191P1bin70 | Isolate | Unclassified |
| 24 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 25 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 26 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 27 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 28 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 29 | 2781125635 | Treponema sp. Co191P1bin60 | Isolate | Unclassified |
| 30 | 2820309449 | Unclassified Firmicutes Th196P1bin10 | Isolate | Unclassified |
| 31 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 32 | 2820757377 | Unclassified Bacteroidetes Mp193P4bin6 | Isolate | Unclassified |
| 33 | 2781125661 | Treponema sp. Emb289P3bin69 | Isolate | Unclassified |
| 34 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 35 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 36 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 37 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 38 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 39 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 40 | 2781125648 | Treponema sp. Co191P3bin70 | Isolate | Unclassified |
| 41 | 2820280018 | Unclassified Firmicutes Th196P3bin149 | Isolate | Unclassified |
| 42 | 2820661146 | Unclassified Firmicutes Co191P3bin61 | Isolate | Unclassified |
| 43 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 44 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 45 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 46 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 47 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 48 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 49 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 50 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 51 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 52 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 53 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 54 | 2820556368 | Unclassified Firmicutes Emb289P3bin92 | Isolate | Unclassified |
| 55 | 2820690275 | Unclassified Firmicutes Co191P1bin72 | Isolate | Unclassified |
| 56 | 2820724199 | Unclassified Cloacimonetes Th196P3bin22 | Isolate | Unclassified |
| 57 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 58 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 59 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 60 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 61 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466732_146808 | 3300042656 | Bacteria | 1951 |
| 2 | Ga0466717_311679 | 3300042604 | Bacteria | 2710 |
| 3 | Ga0466698_451758 | 3300042610 | Bacteria | 2279 |
| 4 | Ga0123353_10237188 | 3300010167 | Bacteria | 2838 |
| 5 | Ga0123354_10046558 | 3300010882 | Bacteria | 6623 |
| 6 | Ga0466703_372211 | 3300042636 | Bacteria | 7523 |
| 7 | Ga0466704_550294 | 3300042643 | Bacteria | 1971 |
| 8 | Ga0415639_008403 | 3300038395 | Bacteria | 13135 |
| 9 | Ga0466692_091252 | 3300042591 | Bacteria | 6032 |
| 10 | Ga0466691_072195 | 3300042593 | Bacteria | 1275 |
| 11 | Ga0466696_131650 | 3300042596 | Bacteria | 2370 |
| 12 | Ga0466705_499595 | 3300042612 | Bacteria | 4434 |
| 13 | Ga0466712_048357 | 3300042614 | Bacteria | 10953 |
| 14 | Ga0466711_026986 | 3300042615 | Unclassified | 6031 |
| 15 | Ga0466718_098596 | 3300042617 | Bacteria | 11558 |
| 16 | Ga0466726_262691 | 3300042619 | Bacteria | 3673 |
| 17 | Ga0466729_183317 | 3300042621 | Bacteria | 1705 |
| 18 | JGI24695J34938_10004665 | 3300002450 | Bacteria | 8900 |
| 19 | Ga0466732_084814 | 3300042656 | Bacteria | 3196 |
| 20 | Ga0466707_173388 | 3300042601 | Bacteria | 3590 |
| 21 | Ga0466719_035931 | 3300042606 | Bacteria | 1325 |
| 22 | Ga0123353_10138108 | 3300010167 | Unclassified | 3908 |
| 23 | Ga0123353_10228992 | 3300010167 | Bacteria | 2900 |
| 24 | Ga0466703_075645 | 3300042636 | Bacteria | 1789 |
| 25 | Ga0466704_028622 | 3300042643 | Bacteria | 2933 |
| 26 | Ga0466704_058354 | 3300042643 | Bacteria | 2576 |
| 27 | Ga0466726_008405 | 3300042619 | Bacteria | 2919 |
| 28 | AustNasuHG_c1006446 | 3300000089 | Bacteria | 4187 |
| 29 | JGI24698J34947_10002374 | 3300002449 | Bacteria | 10135 |
| 30 | JGI24698J34947_10004865 | 3300002449 | Bacteria | 7355 |
| 31 | JGI24702J35022_10009789 | 3300002462 | Bacteria | 5374 |
| 32 | Ga0123357_10305848 | 3300009784 | Bacteria | 1597 |
| 33 | Ga0123356_10494401 | 3300010049 | Bacteria | 1378 |
| 34 | Ga0466703_095112 | 3300042636 | Bacteria | 21951 |
| 35 | Ga0466703_242656 | 3300042636 | Bacteria | 19208 |
| 36 | Ga0415639_000895 | 3300038395 | Bacteria | 89488 |
| 37 | Ga0466728_442073 | 3300042620 | Bacteria | 3315 |
| 38 | AustNasuHG_c1000765 | 3300000089 | Bacteria | 11444 |
| 39 | JGI24695J34938_10019145 | 3300002450 | Bacteria | 3400 |
| 40 | JGI24700J35501_10930860 | 3300002508 | Bacteria | 29144 |
| 41 | Ga0466697_080009 | 3300042611 | Bacteria | 1367 |
| 42 | Ga0123355_10000327 | 3300009826 | Bacteria | 61453 |
| 43 | Ga0123355_10132245 | 3300009826 | Bacteria | 3842 |
| 44 | Ga0123356_10019145 | 3300010049 | Bacteria | 6491 |
| 45 | Ga0123353_10018493 | 3300010167 | Bacteria | 10307 |
| 46 | Ga0123353_10303299 | 3300010167 | Bacteria | 2436 |
| 47 | Ga0466703_043601 | 3300042636 | Bacteria | 4960 |
| 48 | Ga0466703_411723 | 3300042636 | Bacteria | 5099 |
| 49 | Ga0466708_233645 | 3300042652 | Bacteria | 3050 |
| 50 | 2227590732 | 2225789004 | Bacteria | 2424 |
| 51 | JGI24695J34938_10000033 | 3300002450 | Bacteria | 103928 |
| 52 | Ga0466705_248021 | 3300042612 | Bacteria | 13256 |
| 53 | Ga0123355_10123238 | 3300009826 | Bacteria | 4015 |
| 54 | Ga0123355_10191619 | 3300009826 | Bacteria | 3010 |
| 55 | Ga0123353_10001389 | 3300010167 | Archaea | 29647 |
| 56 | Ga0123353_10019635 | 3300010167 | Bacteria | 10054 |
| 57 | Ga0123353_10052296 | 3300010167 | Bacteria | 6522 |
| 58 | Ga0123353_10288626 | 3300010167 | Bacteria | 2513 |
| 59 | Ga0123353_10329820 | 3300010167 | Bacteria | 2311 |
| 60 | Ga0466724_57603 | 3300042649 | Bacteria | 1956 |
| 61 | Ga0466727_030075 | 3300042655 | Bacteria | 3381 |
| 62 | Ga0466692_162010 | 3300042591 | Bacteria | 11092 |
| 63 | Ga0466729_146282 | 3300042621 | Bacteria | 14734 |
| 64 | JGI24699J35502_11133569 | 3300002509 | Bacteria | 12051 |
| 65 | Ga0068305_10038457 | 3300005083 | Bacteria | 16287 |
| 66 | Ga0072940_1062715 | 3300005200 | Bacteria | 5231 |
| 67 | Ga0072940_1256800 | 3300005200 | Bacteria | 4432 |
| 68 | Ga0466706_129494 | 3300042599 | Bacteria | 3266 |
| 69 | Ga0466714_038713 | 3300042603 | Bacteria | 2400 |
| 70 | Ga0466714_081833 | 3300042603 | Bacteria | 1994 |
| 71 | Ga0466722_164020 | 3300042609 | Bacteria | 1922 |
| 72 | Ga0123355_10008925 | 3300009826 | Bacteria | 15191 |
| 73 | Ga0123356_10004195 | 3300010049 | Bacteria | 14935 |
| 74 | Ga0466704_279488 | 3300042643 | Bacteria | 1382 |
| 75 | Ga0415639_018284 | 3300038395 | Unclassified | 19947 |
| 76 | Ga0415639_029268 | 3300038395 | Bacteria | 4829 |
| 77 | Ga0466710_410091 | 3300042613 | Bacteria | 3310 |
| 78 | Ga0466712_030245 | 3300042614 | Bacteria | 12187 |
| 79 | Ga0466718_158596 | 3300042617 | Bacteria | 5083 |
| 80 | JGI24698J34947_10000914 | 3300002449 | Bacteria | 14965 |
| 81 | JGI24695J34938_10005588 | 3300002450 | Bacteria | 7793 |
| 82 | JGI24695J34938_10053947 | 3300002450 | Bacteria | 1746 |
| 83 | JGI24702J35022_10001478 | 3300002462 | Bacteria | 14577 |
| 84 | JGI24699J35502_11134214 | 3300002509 | Bacteria | 63548 |
| 85 | Ga0466732_191983 | 3300042656 | Unclassified | 4493 |
| 86 | Ga0466719_305788 | 3300042606 | Bacteria | 1886 |
| 87 | Ga0466722_125970 | 3300042609 | Bacteria | 5566 |
| 88 | Ga0123356_10001116 | 3300010049 | Bacteria | 29729 |
| 89 | Ga0123353_10127107 | 3300010167 | Bacteria | 4096 |
| 90 | Ga0466702_041907 | 3300042635 | Bacteria | 3556 |
| 91 | Ga0466727_057148 | 3300042655 | Bacteria | 4087 |
| 92 | Ga0415639_053047 | 3300038395 | Bacteria | 2803 |
| 93 | Ga0466690_070389 | 3300042590 | Bacteria | 1670 |
| 94 | Ga0466690_429756 | 3300042590 | Bacteria | 2319 |
| 95 | Ga0466699_231096 | 3300042597 | Bacteria | 2598 |
| 96 | Ga0466712_185454 | 3300042614 | Bacteria | 3220 |
| 97 | Ga0466718_097734 | 3300042617 | Bacteria | 12322 |
| 98 | Ga0466718_106000 | 3300042617 | Bacteria | 1695 |
| 99 | JGI24695J34938_10010367 | 3300002450 | Bacteria | 5106 |
| 100 | JGI24695J34938_10026960 | 3300002450 | Bacteria | 2722 |
| 101 | JGI24702J35022_10020346 | 3300002462 | Archaea | 3603 |
| 102 | Ga0466733_017665 | 3300042659 | Bacteria | 2444 |
| 103 | Ga0466701_024833 | 3300042598 | Bacteria | 2373 |
| 104 | Ga0466706_207265 | 3300042599 | Bacteria | 12165 |
| 105 | Ga0466721_076472 | 3300042608 | Bacteria | 101745 |
| 106 | Ga0123357_10041208 | 3300009784 | Bacteria | 6279 |
| 107 | Ga0123356_10053800 | 3300010049 | Bacteria | 3748 |
| 108 | Ga0123356_10079580 | 3300010049 | Bacteria | 3096 |
| 109 | Ga0123353_10038325 | 3300010167 | Bacteria | 7531 |
| 110 | Ga0123353_10111969 | 3300010167 | Bacteria | 4395 |
| 111 | Ga0123353_10367650 | 3300010167 | Bacteria | 2158 |
| 112 | Ga0466702_121631 | 3300042635 | Bacteria | 6295 |
| 113 | Ga0466725_379349 | 3300042654 | Bacteria | 1464 |
| 114 | Ga0415639_060710 | 3300038395 | Bacteria | 5147 |
| 115 | Ga0466712_194399 | 3300042614 | Bacteria | 10012 |
| 116 | Ga0466718_149393 | 3300042617 | Bacteria | 4963 |
| 117 | Ga0466723_198202 | 3300042618 | Bacteria | 15170 |
| 118 | Ga0466726_147041 | 3300042619 | Bacteria | 10635 |
| 119 | AustNasuHG_c1008834 | 3300000089 | Unclassified | 3561 |
| 120 | JGI24695J34938_10000211 | 3300002450 | Bacteria | 55384 |
| 121 | JGI24695J34938_10008369 | 3300002450 | Bacteria | 5911 |
| 122 | Ga0068305_10187155 | 3300005083 | Bacteria | 4598 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.