Protein Family IF11764

Metagenome Isolate
115 Members
41 Samples
108 Scaffolds
384.03 Avg Length

🧬 Representative Sequence

ID
iso_pr_bacteria|2781125643|2781293485|
Length
414 aa
Sequence
MEQLKHDGKKKPSARSDQDKQKRVYFDWAASSPDNTYNSFSFLDKEIFRTGFANPSSSMHLEGRSAKKILEESRERCAAVLKVPPETLYFTSGGTESNSIALLSNLTRPGKGRIISSQAEHASVRDAMLTLEKMGKPTGNIPVDSSGKVTPASLSKTLEKYGDVRFISVMSVNNETGVVTDIASLSNEIKKYREYSADSASSLKNPVHFHCDMVQAAGKIKIDIDGWDIDSASISAHKIQGPRGIGLLYAKKPLNVFYSGGGQENGVRGGTENVYGAFALADCLEKYASSAETEYQNAKTRIKKLITSLCAMKRCVLIPKSRLADDDNFSPYILQAAFKDIPGEVMARALDDLGFAVSTGSACSSSSPERPVLIAMGVEENLRIEGIRISQGHTTTDKDIDLLTGAVNEVLKFL

📊 Sample Types

Isolate 6.1%
Metagenome 93.9%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 53.8%
Kalotermitidae 23.1%
Unclassified 17.9%
Rhinotermitidae 2.6%
Termopsidae 2.6%

🌳 Taxonomy

Archaea 2
Bacteria 106
Eukaryota 0
Viruses 0
Unclassified 7

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
2 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
3 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
4 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
5 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
6 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
7 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
8 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
9 3300002507 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P1 Metagenome Termitidae
10 2781125662 Treponema sp. Emb289P3bin141 Isolate Unclassified
11 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
12 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
13 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
14 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
15 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
16 2781125643 Treponema sp. Co191P3bin45 Isolate Unclassified
17 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
18 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
19 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
20 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
21 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
22 2781125637 Treponema sp. Co191P1bin9 Isolate Unclassified
23 2781125646 Treponema sp. Co191P3bin59 Isolate Unclassified
24 2781125692 Treponema sp. Th196P3bin31 Isolate Unclassified
25 3300005485 Termite gut microbial communities from Costa Rica - P3 luminal contents Metagenome Termitidae
26 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
27 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
28 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
29 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
30 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
31 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
32 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
33 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
34 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
35 2781125656 Treponema sp. Emb289P1bin65 Isolate Unclassified
36 2781125663 Treponema sp. Emb289P3bin135 Isolate Unclassified
37 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
38 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
39 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
40 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
41 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0415639_070409 3300038395 Bacteria 9032
2 Ga0466694_027441 3300042594 Bacteria 4143
3 Ga0123356_10017101 3300010049 Bacteria 6903
4 Ga0123356_10271110 3300010049 Bacteria 1787
5 Ga0466720_062418 3300042607 Bacteria 27320
6 JGI24698J34947_10001486 3300002449 Bacteria 12382
7 JGI24695J34938_10039980 3300002450 Archaea 2115
8 Ga0072941_1011382 3300005201 Bacteria 14196
9 Ga0466731_204697 3300042622 Unclassified 36475
10 Ga0466703_116692 3300042636 Bacteria 2876
11 Ga0466704_446877 3300042643 Unclassified 5480
12 Ga0466704_620223 3300042643 Bacteria 3527
13 Ga0466712_160235 3300042614 Bacteria 3843
14 Ga0466728_006075 3300042620 Bacteria 2838
15 Ga0466728_139623 3300042620 Bacteria 4754
16 Ga0466732_409124 3300042656 Bacteria 27790
17 Ga0264413_100925 3300024493 Bacteria 14246
18 Ga0466690_270749 3300042590 Bacteria 3865
19 Ga0466691_219039 3300042593 Bacteria 5841
20 Ga0466699_305732 3300042597 Bacteria 1782
21 Ga0123356_10001635 3300010049 Bacteria 24595
22 Ga0123356_10199246 3300010049 Bacteria 2040
23 Ga0123353_10033009 3300010167 Bacteria 8049
24 Ga0466719_029315 3300042606 Bacteria 3328
25 JGI24698J34947_10003025 3300002449 Bacteria 9107
26 JGI24698J34947_10006050 3300002449 Bacteria 6645
27 JGI24699J35502_11075036 3300002509 Bacteria 1894
28 Ga0072941_1011381 3300005201 Bacteria 1820
29 Ga0466731_125925 3300042622 Bacteria 2494
30 Ga0466702_126037 3300042635 Bacteria 1499
31 Ga0466702_170759 3300042635 Bacteria 13024
32 Ga0466708_291823 3300042652 Unclassified 2746
33 Ga0466712_091980 3300042614 Bacteria 13610
34 Ga0466723_210196 3300042618 Bacteria 26496
35 Ga0466694_325482 3300042594 Bacteria 2324
36 Ga0466699_101104 3300042597 Bacteria 3784
37 Ga0466720_107502 3300042607 Bacteria 22377
38 Ga0074263_108383 3300005485 Bacteria 4105
39 Ga0466702_463216 3300042635 Bacteria 1483
40 Ga0466727_325429 3300042655 Bacteria 4165
41 Ga0466712_254560 3300042614 Unclassified 2835
42 Ga0466723_123780 3300042618 Bacteria 2296
43 Ga0466705_120802 3300042612 Bacteria 4235
44 Ga0415639_015547 3300038395 Bacteria 22627
45 Ga0466699_018113 3300042597 Bacteria 33087
46 JGI24698J34947_10004339 3300002449 Bacteria 7722
47 JGI24698J34947_10008053 3300002449 Bacteria 5785
48 Ga0072940_1053141 3300005200 Bacteria 4015
49 Ga0072941_1065288 3300005201 Bacteria 3301
50 Ga0466723_219816 3300042618 Bacteria 36008
51 Ga0466705_160199 3300042612 Bacteria 1997
52 Ga0264413_124950 3300024493 Bacteria 4008
53 Ga0466694_040166 3300042594 Bacteria 11040
54 Ga0466694_107812 3300042594 Bacteria 14039
55 Ga0123356_10154766 3300010049 Bacteria 2281
56 AustNasuHG_c1036012 3300000089 Unclassified 1292
57 JGI24695J34938_10000016 3300002450 Bacteria 116336
58 JGI24695J34938_10004202 3300002450 Bacteria 9575
59 Ga0072940_1000509 3300005200 Bacteria 4198
60 Ga0466702_350760 3300042635 Bacteria 11855
61 Ga0466712_045629 3300042614 Bacteria 41120
62 Ga0466728_075686 3300042620 Bacteria 7337
63 Ga0264413_115643 3300024493 Bacteria 8410
64 Ga0466690_105837 3300042590 Bacteria 4443
65 Ga0466693_450355 3300042592 Bacteria 3790
66 Ga0466691_027229 3300042593 Bacteria 11950
67 Ga0123356_10029401 3300010049 Bacteria 5146
68 Ga0466720_109617 3300042607 Bacteria 5678
69 JGI24698J34947_10005049 3300002449 Bacteria 7232
70 Ga0466712_005921 3300042614 Bacteria 1413
71 Ga0466712_036880 3300042614 Bacteria 9922
72 Ga0466712_041916 3300042614 Bacteria 16385
73 Ga0466718_003255 3300042617 Archaea 2785
74 Ga0466694_192118 3300042594 Unclassified 9990
75 Ga0466699_020088 3300042597 Bacteria 7667
76 Ga0466699_126357 3300042597 Bacteria 3464
77 Ga0123356_10179359 3300010049 Bacteria 2138
78 Ga0466720_081062 3300042607 Bacteria 39537
79 Ga0466722_085739 3300042609 Bacteria 4699
80 JGI24698J34947_10075945 3300002449 Bacteria 1595
81 JGI24695J34938_10000301 3300002450 Bacteria 48723
82 JGI24695J34938_10000319 3300002450 Bacteria 47237
83 Ga0072941_1010736 3300005201 Bacteria 42532
84 Ga0466702_305208 3300042635 Bacteria 1927
85 Ga0466704_498447 3300042643 Bacteria 1940
86 Ga0466712_019313 3300042614 Bacteria 3430
87 Ga0466712_226564 3300042614 Bacteria 10213
88 Ga0466718_076149 3300042617 Bacteria 15780
89 Ga0264413_107507 3300024493 Bacteria 5249
90 Ga0466694_109729 3300042594 Bacteria 11224
91 Ga0466699_258762 3300042597 Bacteria 52150
92 Ga0466699_289173 3300042597 Unclassified 6963
93 Ga0123355_10127050 3300009826 Bacteria 3937
94 Ga0123356_10000239 3300010049 Bacteria 63302
95 Ga0123356_10051051 3300010049 Bacteria 3847
96 Ga0466722_006553 3300042609 Bacteria 3499
97 Ga0466722_055492 3300042609 Bacteria 15765
98 Ga0466698_284999 3300042610 Bacteria 1728
99 JGI24698J34947_10000867 3300002449 Bacteria 15257
100 JGI24698J34947_10004588 3300002449 Bacteria 7529
101 JGI24698J34947_10017237 3300002449 Bacteria 3917
102 JGI24698J34947_10097167 3300002449 Bacteria 1334
103 JGI24697J35500_11273503 3300002507 Bacteria 5707
104 Ga0074263_114274 3300005485 Bacteria 1810
105 Ga0466708_400826 3300042652 Bacteria 19843
106 Ga0466712_073702 3300042614 Bacteria 60864
107 Ga0466712_118083 3300042614 Bacteria 55745
108 Ga0466718_039098 3300042617 Bacteria 4982

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00266 Aminotran_5 Aminotransferase class-V 25 403 0.83

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.