Protein Family IF11749

Metagenome Isolate
193 Members
61 Samples
174 Scaffolds
552.9 Avg Length

🧬 Representative Sequence

ID
iso_pr_bacteria|2781125634|2781274656|
Length
613 aa
Sequence
MPRRKTNPIKITNLQNTGSGSGWIKETFYNLALMFLAAILFAASHPNLLFYNGLPFFAWFAYIPVVILINRNNVIQCIGWGALYGFAAYGFYAYWLSAFHPLAGVIVYCIYIVYFAVTFPILKLACILFPKRSYLAQWVVWLAYEYLSMQGFTGFPYGITGYTQWRITPLIQIASLAGVWGVNVLVTFPSFWLAGAIINTSRENVIPNREGAIKKEEKNLPQTHTETKSRFNFYSLIRAGSHRFAVKNLKNYFLQEKIPAIIWGAALAASLVFGFVTLKDYSDTIAAGNYSSAQIALIXHXTDPWEASKASSSWLIXEAYRKDLRILKRLSDAALNANPDIQLVVWSETAFVPRIYWHTTYREEQNSWEIVRELLEYLSSKDVPFLLGNDDARKDPAVNPNASDQHRVDYNAVMYFEKGNNTKTYRKLHLVPFTEHFPYRKQFPMIYDWLVSADTHFWEKGNEAAVFTGPGFTFSTPICFEDTFGYLSREFVRGGADVIINLSNDAWSNSVTAQYQHLSMAVFRAVENYRPMARSTASGQTCAVDPLGRIISMAPSFEETYLDVSIPLIKKDTLYTKFGDYLGVFSVWAAIAILLFGAVCYTMRKLKARTERH

📊 Sample Types

Isolate 9.8%
Metagenome 90.2%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 37.9%
Unclassified 32.8%
Kalotermitidae 19.0%
Rhinotermitidae 5.2%
Termopsidae 3.4%
Hodotermitidae 1.7%

🌳 Taxonomy

Archaea 0
Bacteria 189
Eukaryota 0
Viruses 1
Unclassified 3

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2781125661 Treponema sp. Emb289P3bin69 Isolate Unclassified
2 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
3 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
4 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
5 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
6 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
7 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
8 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
9 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
10 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
11 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
12 2781125637 Treponema sp. Co191P1bin9 Isolate Unclassified
13 2781125682 Treponema sp. Lab288P1bin107 Isolate Unclassified
14 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
15 3300002508 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 Metagenome Termitidae
16 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
17 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
18 2781125643 Treponema sp. Co191P3bin45 Isolate Unclassified
19 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
20 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
21 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
22 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
23 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
24 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
25 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
26 2772190978 Treponema sp. Nt197P3bin57 Isolate Unclassified
27 2781125632 Treponema sp. Co191P1bin87 Isolate Unclassified
28 2781125635 Treponema sp. Co191P1bin60 Isolate Unclassified
29 2781125655 Treponema sp. Emb289P1bin105 Isolate Unclassified
30 2781125662 Treponema sp. Emb289P3bin141 Isolate Unclassified
31 2819994798 Unclassified Spirochaetes Th196P1bin3 Isolate Unclassified
32 2820020240 Unclassified Spirochaetes Nc150P3bin10 Isolate Unclassified
33 3300001880 Termite hindgut microbial communities from the Max Planck Institute, Bremen, Germany, analyzing fibers in the hindgut lumen - ASSEMBLED Fiber-Associated Metagenome Metagenome
34 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
35 2781125660 Treponema sp. Emb289P3bin52 Isolate Unclassified
36 2819992462 Unclassified Spirochaetes Nc150P4bin14 Isolate Unclassified
37 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
38 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
39 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
40 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
41 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
42 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
43 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
44 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
45 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
46 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
47 2781125634 Treponema sp. Co191P1bin45 Isolate Unclassified
48 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
49 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
50 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
51 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
52 2781125644 Treponema sp. Co191P3bin12 Isolate Unclassified
53 2781125645 Treponema sp. Co191P3bin32 Isolate Unclassified
54 2781125656 Treponema sp. Emb289P1bin65 Isolate Unclassified
55 2781125663 Treponema sp. Emb289P3bin135 Isolate Unclassified
56 2781125665 Treponema sp. Emb289P3bin117 Isolate Unclassified
57 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
58 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
59 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
60 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
61 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_095353 3300042612 Bacteria 9337
2 Ga0466705_129537 3300042612 Bacteria 11007
3 Ga0466705_381098 3300042612 Bacteria 15624
4 Ga0466732_429868 3300042656 Unclassified 4917
5 Ga0466712_314821 3300042614 Bacteria 22070
6 Ga0466711_202535 3300042615 Bacteria 5041
7 Ga0466711_299738 3300042615 Bacteria 33209
8 Ga0466718_102902 3300042617 Bacteria 14298
9 Ga0466726_410952 3300042619 Bacteria 12717
10 Ga0415639_001719 3300038395 Bacteria 19674
11 Ga0466692_164656 3300042591 Bacteria 21408
12 Ga0466720_149851 3300042607 Bacteria 3434
13 Ga0466722_124305 3300042609 Bacteria 15678
14 Ga0123356_10000269 3300010049 Bacteria 59524
15 AustNasuHG_c1003409 3300000089 Bacteria 5740
16 JGI24698J34947_10006504 3300002449 Bacteria 6411
17 JGI24698J34947_10030427 3300002449 Bacteria 2847
18 JGI24695J34938_10000139 3300002450 Bacteria 65941
19 JGI24695J34938_10000637 3300002450 Bacteria 33482
20 Ga0072941_1001745 3300005201 Bacteria 10853
21 Ga0072941_1125386 3300005201 Bacteria 2445
22 Ga0466702_004209 3300042635 Bacteria 8955
23 Ga0466703_256203 3300042636 Bacteria 13678
24 Ga0466733_062653 3300042659 Bacteria 8413
25 Ga0466712_034226 3300042614 Bacteria 11987
26 Ga0466712_112470 3300042614 Bacteria 9678
27 Ga0466718_025713 3300042617 Bacteria 9249
28 Ga0466718_078022 3300042617 Bacteria 5978
29 Ga0466718_139719 3300042617 Bacteria 21255
30 Ga0466718_143385 3300042617 Bacteria 10840
31 Ga0264413_114977 3300024493 Bacteria 37616
32 Ga0415639_067896 3300038395 Bacteria 4435
33 Ga0466690_164343 3300042590 Unclassified 15186
34 Ga0466694_072572 3300042594 Bacteria 10607
35 Ga0466694_332686 3300042594 Bacteria 14748
36 Ga0466695_357140 3300042595 Bacteria 35004
37 Ga0466699_145390 3300042597 Bacteria 2034
38 Ga0466719_254831 3300042606 Bacteria 7201
39 Ga0123356_10026761 3300010049 Bacteria 5412
40 FAAS_10001006 3300001880 Bacteria 2683
41 JGI24698J34947_10006121 3300002449 Bacteria 6604
42 JGI24695J34938_10001101 3300002450 Bacteria 24350
43 JGI24695J34938_10003321 3300002450 Bacteria 11335
44 JGI24700J35501_10930873 3300002508 Bacteria 31057
45 Ga0072941_1005929 3300005201 Bacteria 10342
46 Ga0072941_1008842 3300005201 Bacteria 7584
47 Ga0072941_1032758 3300005201 Bacteria 9046
48 Ga0072941_1142980 3300005201 Bacteria 2426
49 Ga0466703_261658 3300042636 Bacteria 6484
50 Ga0466703_302424 3300042636 Bacteria 27052
51 Ga0466727_298644 3300042655 Bacteria 26837
52 Ga0466732_008846 3300042656 Bacteria 18049
53 Ga0466718_040204 3300042617 Bacteria 13075
54 Ga0466723_158778 3300042618 Bacteria 4081
55 Ga0466726_258461 3300042619 Bacteria 8266
56 Ga0466694_044360 3300042594 Bacteria 13614
57 Ga0466694_050416 3300042594 Bacteria 11268
58 Ga0466699_034402 3300042597 Bacteria 10049
59 Ga0466699_173396 3300042597 Bacteria 8988
60 Ga0466716_337682 3300042605 Bacteria 39319
61 Ga0466720_090063 3300042607 Bacteria 5155
62 Ga0466722_068218 3300042609 Bacteria 5421
63 Ga0123356_10021801 3300010049 Bacteria 6048
64 AustNasuHG_c1000705 3300000089 Bacteria 11869
65 JGI24698J34947_10000003 3300002449 Bacteria 62691
66 JGI24698J34947_10000241 3300002449 Bacteria 22787
67 JGI24698J34947_10028473 3300002449 Bacteria 2957
68 Ga0072941_1115163 3300005201 Bacteria 2473
69 Ga0466729_275062 3300042621 Unclassified 1833
70 Ga0466702_466217 3300042635 Bacteria 13914
71 Ga0466712_056613 3300042614 Bacteria 12902
72 Ga0466712_102182 3300042614 Bacteria 7828
73 Ga0466712_147256 3300042614 Bacteria 5239
74 Ga0466712_165200 3300042614 Bacteria 7046
75 Ga0466712_198645 3300042614 Bacteria 11816
76 Ga0466711_134157 3300042615 Bacteria 18978
77 Ga0466715_341314 3300042616 Bacteria 4527
78 Ga0466718_149328 3300042617 Bacteria 9484
79 Ga0466693_002405 3300042592 Bacteria 54310
80 Ga0466694_081947 3300042594 Bacteria 6292
81 Ga0466722_235264 3300042609 Bacteria 4514
82 Ga0123356_10000325 3300010049 Bacteria 54913
83 Ga0123356_10000453 3300010049 Bacteria 46109
84 JGI24698J34947_10007356 3300002449 Bacteria 6054
85 JGI24698J34947_10016650 3300002449 Bacteria 3988
86 JGI24695J34938_10000121 3300002450 Bacteria 70058
87 JGI24695J34938_10000553 3300002450 Bacteria 36121
88 JGI24695J34938_10003362 3300002450 Bacteria 11246
89 JGI24695J34938_10009914 3300002450 Bacteria 5260
90 Ga0072941_1045063 3300005201 Bacteria 3140
91 Ga0466702_270986 3300042635 Bacteria 10280
92 Ga0466709_408936 3300042648 Bacteria 32738
93 Ga0466732_012973 3300042656 Bacteria 30059
94 Ga0466733_186342 3300042659 Bacteria 6645
95 Ga0466712_026369 3300042614 Bacteria 22902
96 Ga0466712_050058 3300042614 Bacteria 14359
97 Ga0466712_175957 3300042614 Bacteria 10105
98 Ga0466718_031808 3300042617 Bacteria 11464
99 Ga0466718_053207 3300042617 Bacteria 3487
100 Ga0466718_066140 3300042617 Bacteria 3261
101 Ga0466718_098993 3300042617 Bacteria 13891
102 Ga0466718_100236 3300042617 Bacteria 32234
103 Ga0466718_165921 3300042617 Bacteria 3153
104 Ga0264413_101674 3300024493 Bacteria 16699
105 Ga0466693_253926 3300042592 Bacteria 16135
106 Ga0466694_020203 3300042594 Bacteria 8825
107 Ga0466719_357957 3300042606 Bacteria 18713
108 Ga0466720_037483 3300042607 Bacteria 3488
109 Ga0466720_057211 3300042607 Bacteria 3950
110 Ga0466722_215830 3300042609 Bacteria 11784
111 Ga0123353_10130242 3300010167 Bacteria 4038
112 AustNasuHG_c1000139 3300000089 Bacteria 22520
113 JGI24698J34947_10002045 3300002449 Bacteria 10766
114 JGI24698J34947_10011218 3300002449 Bacteria 4920
115 JGI24698J34947_10063679 3300002449 Bacteria 1806
116 JGI24695J34938_10000947 3300002450 Bacteria 26470
117 JGI24695J34938_10031214 3300002450 Bacteria 2474
118 Ga0072941_1006051 3300005201 Bacteria 5239
119 Ga0072941_1168331 3300005201 Bacteria 2207
120 Ga0466704_580010 3300042643 Bacteria 10728
121 Ga0466712_060585 3300042614 Bacteria 4826
122 Ga0466712_149807 3300042614 Bacteria 5337
123 Ga0466718_006444 3300042617 Bacteria 75149
124 Ga0466718_047268 3300042617 Bacteria 7832
125 Ga0466694_021996 3300042594 Bacteria 62944
126 Ga0466699_425188 3300042597 Bacteria 97421
127 Ga0466700_157299 3300042600 Bacteria 11405
128 Ga0466717_297187 3300042604 Bacteria 1796
129 Ga0466720_048686 3300042607 Bacteria 8213
130 Ga0466720_226106 3300042607 Bacteria 4541
131 Ga0123355_10081486 3300009826 Bacteria 5164
132 Ga0123356_10000067 3300010049 Bacteria 109410
133 Ga0123356_10017470 3300010049 Bacteria 6824
134 JGI24695J34938_10001502 3300002450 Bacteria 19698
135 Ga0072941_1078236 3300005201 Bacteria 6386
136 Ga0072941_1142978 3300005201 Bacteria 2035
137 Ga0466731_186790 3300042622 Bacteria 8951
138 Ga0466731_334782 3300042622 Viruses 8237
139 Ga0466704_168065 3300042643 Bacteria 24797
140 Ga0466712_138271 3300042614 Bacteria 13571
141 Ga0466715_229437 3300042616 Bacteria 20911
142 Ga0466718_059386 3300042617 Bacteria 2316
143 Ga0466718_091341 3300042617 Bacteria 6874
144 Ga0466699_337164 3300042597 Bacteria 4272
145 Ga0466720_008542 3300042607 Bacteria 40016
146 Ga0466722_193539 3300042609 Bacteria 2020
147 Ga0123356_10011644 3300010049 Bacteria 8566
148 Ga0123356_10098273 3300010049 Bacteria 2803
149 JGI24698J34947_10002998 3300002449 Bacteria 9155
150 JGI24698J34947_10003010 3300002449 Bacteria 9134
151 JGI24698J34947_10012527 3300002449 Bacteria 4648
152 JGI24695J34938_10007280 3300002450 Bacteria 6518
153 JGI24695J34938_10032174 3300002450 Bacteria 2426
154 Ga0072941_1036611 3300005201 Bacteria 2490
155 Ga0466703_341823 3300042636 Bacteria 31757
156 Ga0466733_140083 3300042659 Bacteria 3196
157 Ga0466712_018159 3300042614 Bacteria 19531
158 Ga0466712_317612 3300042614 Bacteria 15050
159 Ga0264413_135444 3300024493 Bacteria 8551
160 Ga0415639_017292 3300038395 Bacteria 10383
161 Ga0415639_104612 3300038395 Bacteria 2674
162 Ga0466694_021873 3300042594 Bacteria 13224
163 Ga0466696_019604 3300042596 Bacteria 17380
164 Ga0466706_289794 3300042599 Bacteria 2770
165 Ga0466700_135616 3300042600 Bacteria 6234
166 Ga0466719_293767 3300042606 Bacteria 39762
167 Ga0466720_014621 3300042607 Bacteria 102324
168 Ga0466722_125836 3300042609 Bacteria 6886
169 Ga0123355_10002359 3300009826 Bacteria 26671
170 JGI24698J34947_10002441 3300002449 Bacteria 10013
171 JGI24695J34938_10000010 3300002450 Bacteria 132147
172 JGI24695J34938_10030990 3300002450 Bacteria 2486
173 Ga0072940_1023360 3300005200 Bacteria 34349
174 Ga0072941_1005931 3300005201 Bacteria 16771

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF20154 LNT_N Apolipoprotein N-acyltransferase N-terminal domain 38 188 0.88
PF00795 CN_hydrolase Carbon-nitrogen hydrolase 327 568 0.84

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF00795 GO:0006807 obsolete nitrogen compound metabolic process BP

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.