Protein Family IF11741

Metagenome Isolate
110 Members
42 Samples
104 Scaffolds
223.53 Avg Length

🧬 Representative Sequence

ID
iso_pr_bacteria|2781125632|2781269914|
Length
257 aa
Sequence
MKSWGLVQFNESLPVFPPTCSLLPVILYLIMRIPLTRYGLPQVVIFPLIVIIAMLTLFVTNWPALWLIPVQVILLAVLVWAFSFFRDPERKIIPDENILYSPADGTITDIDEVDDTALGTRALRIGMFLSVFNVHVNRVPCSVRIEKVMYKKGKFINAMSTESSRINESNDTLMTRLSEPKDKLLVRQISGAIARHIVCEAKEGREYRQGQQFGMIKFGSRAELYLPLADDKRRYEVAVKIGEPVRAGLTPLVRYLP

📊 Sample Types

Isolate 5.5%
Metagenome 94.5%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 55.0%
Unclassified 20.0%
Kalotermitidae 15.0%
Termopsidae 5.0%
Hodotermitidae 2.5%
Rhinotermitidae 2.5%

🌳 Taxonomy

Archaea 0
Bacteria 106
Eukaryota 0
Viruses 0
Unclassified 4

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
2 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
3 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
4 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
5 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
6 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
7 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
8 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
9 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
10 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
11 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
12 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
13 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
14 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
15 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
16 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
17 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
18 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
19 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
20 2781125681 Treponema sp. Lab288P1bin11 Isolate Unclassified
21 2781125690 Treponema sp. Th196P3bin63 Isolate Unclassified
22 2781125691 Treponema sp. Th196P3bin73 Isolate Unclassified
23 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
24 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
25 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
26 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
27 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
28 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
29 2781125639 Treponema sp. Co191P1bin44 Isolate Unclassified
30 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
31 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
32 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
33 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
34 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
35 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
36 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
37 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
38 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
39 2781125632 Treponema sp. Co191P1bin87 Isolate Unclassified
40 2781125655 Treponema sp. Emb289P1bin105 Isolate Unclassified
41 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
42 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466699_389694 3300042597 Bacteria 1141
2 Ga0466701_043303 3300042598 Bacteria 1203
3 Ga0466720_070033 3300042607 Bacteria 6159
4 Ga0466722_211149 3300042609 Bacteria 1574
5 JGI24698J34947_10003268 3300002449 Bacteria 8782
6 JGI24702J35022_10057485 3300002462 Bacteria 2077
7 Ga0072941_1028723 3300005201 Bacteria 3617
8 Ga0072941_1033526 3300005201 Bacteria 2613
9 Ga0466712_303630 3300042614 Bacteria 2734
10 Ga0466711_005599 3300042615 Bacteria 8490
11 Ga0466715_220957 3300042616 Bacteria 2111
12 Ga0466735_154276 3300042624 Bacteria 2230
13 Ga0466703_274618 3300042636 Bacteria 1479
14 Ga0466694_056243 3300042594 Bacteria 7013
15 Ga0466699_336212 3300042597 Bacteria 10968
16 Ga0123357_10007038 3300009784 Bacteria 13848
17 Ga0123357_10081443 3300009784 Bacteria 4254
18 Ga0123354_10194487 3300010882 Bacteria 2257
19 Ga0466720_018621 3300042607 Bacteria 1869
20 AustNasuHG_c1001635 3300000089 Bacteria 8069
21 JGI24698J34947_10012506 3300002449 Bacteria 4652
22 JGI24698J34947_10012946 3300002449 Bacteria 4558
23 JGI24698J34947_10020616 3300002449 Bacteria 3549
24 JGI24698J34947_10023575 3300002449 Bacteria 3292
25 JGI24698J34947_10034000 3300002449 Unclassified 2671
26 JGI24698J34947_10122677 3300002449 Bacteria 1124
27 JGI24695J34938_10007951 3300002450 Bacteria 6127
28 Ga0072941_1004713 3300005201 Bacteria 29980
29 Ga0072941_1054271 3300005201 Bacteria 4915
30 Ga0072941_1143771 3300005201 Bacteria 3760
31 Ga0466712_028136 3300042614 Bacteria 15328
32 Ga0466712_036417 3300042614 Unclassified 5404
33 Ga0466693_026737 3300042592 Bacteria 1337
34 Ga0466719_232270 3300042606 Bacteria 4016
35 JGI24698J34947_10002864 3300002449 Bacteria 9361
36 JGI24702J35022_10000370 3300002462 Bacteria 26677
37 JGI24699J35502_10823466 3300002509 Unclassified 912
38 Ga0072941_1059563 3300005201 Bacteria 8880
39 Ga0466712_060371 3300042614 Bacteria 4828
40 Ga0466712_103331 3300042614 Bacteria 13527
41 Ga0466712_256284 3300042614 Bacteria 2948
42 Ga0466708_143876 3300042652 Bacteria 11312
43 Ga0466732_239552 3300042656 Bacteria 1747
44 Ga0466693_232206 3300042592 Bacteria 14878
45 Ga0466695_331872 3300042595 Bacteria 5608
46 Ga0466699_124527 3300042597 Bacteria 4135
47 Ga0123354_10134407 3300010882 Bacteria 3103
48 Ga0466707_051365 3300042601 Bacteria 1875
49 JGI24698J34947_10016830 3300002449 Bacteria 3966
50 JGI24698J34947_10023238 3300002449 Bacteria 3317
51 JGI24702J35022_10217069 3300002462 Bacteria 1100
52 Ga0466712_096463 3300042614 Unclassified 1056
53 Ga0466715_399910 3300042616 Bacteria 1966
54 Ga0264413_114226 3300024493 Bacteria 3182
55 Ga0466699_000881 3300042597 Bacteria 5103
56 Ga0466699_409379 3300042597 Bacteria 1310
57 JGI24698J34947_10000299 3300002449 Bacteria 21601
58 JGI24698J34947_10012666 3300002449 Bacteria 4619
59 JGI24698J34947_10076490 3300002449 Bacteria 1587
60 Ga0466712_020533 3300042614 Bacteria 4158
61 Ga0466712_172921 3300042614 Bacteria 3048
62 Ga0466715_527255 3300042616 Bacteria 14696
63 Ga0466735_111076 3300042624 Bacteria 10783
64 Ga0415639_094625 3300038395 Bacteria 3128
65 Ga0123355_10001344 3300009826 Bacteria 34139
66 Ga0466706_026793 3300042599 Bacteria 18030
67 Ga0466716_159875 3300042605 Bacteria 4871
68 Ga0466720_204731 3300042607 Bacteria 1453
69 AustNasuHG_c1049519 3300000089 Bacteria 913
70 JGI24699J35502_11133422 3300002509 Bacteria 10471
71 Ga0466712_022492 3300042614 Bacteria 11696
72 Ga0466711_236630 3300042615 Bacteria 6972
73 Ga0466731_408828 3300042622 Bacteria 1899
74 Ga0466693_320726 3300042592 Bacteria 2637
75 Ga0466694_391408 3300042594 Bacteria 1403
76 Ga0466699_090943 3300042597 Bacteria 11514
77 Ga0123356_11224737 3300010049 Bacteria 916
78 Ga0466707_173783 3300042601 Bacteria 1256
79 Ga0466720_021829 3300042607 Bacteria 9541
80 JGI24698J34947_10006701 3300002449 Bacteria 6324
81 JGI24698J34947_10022882 3300002449 Bacteria 3347
82 JGI24698J34947_10076476 3300002449 Bacteria 1587
83 Ga0072940_1049372 3300005200 Bacteria 3107
84 Ga0466712_206284 3300042614 Bacteria 8083
85 Ga0466718_117961 3300042617 Bacteria 51293
86 Ga0466718_121783 3300042617 Bacteria 2435
87 Ga0466727_093493 3300042655 Bacteria 3023
88 Ga0466732_066182 3300042656 Bacteria 5627
89 Ga0264413_115575 3300024493 Bacteria 2225
90 Ga0415639_080371 3300038395 Bacteria 6506
91 Ga0466694_406717 3300042594 Bacteria 27989
92 Ga0123353_10158144 3300010167 Bacteria 3610
93 Ga0466720_238288 3300042607 Bacteria 1015
94 Ga0466722_066150 3300042609 Bacteria 2592
95 JGI24698J34947_10017685 3300002449 Bacteria 3860
96 JGI24698J34947_10040850 3300002449 Bacteria 2393
97 JGI24702J35022_10006772 3300002462 Bacteria 6600
98 Ga0068305_10118427 3300005083 Bacteria 5405
99 Ga0466712_094137 3300042614 Bacteria 2698
100 Ga0466712_150205 3300042614 Bacteria 5208
101 Ga0466711_098426 3300042615 Bacteria 2986
102 Ga0466715_447333 3300042616 Bacteria 4255
103 Ga0466715_519413 3300042616 Bacteria 1593
104 Ga0466708_191945 3300042652 Bacteria 1455

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300002449 JGI24698J34947_10017685 JGI24698J34947_100176853 201
2 3300042614 Ga0466712_036417 Ga0466712_036417_2064_2672 202
3 3300042614 Ga0466712_103331 Ga0466712_103331_7859_8467 202
4 3300042614 Ga0466712_172921 Ga0466712_172921_2345_2953 202
5 3300042614 Ga0466712_206284 Ga0466712_206284_4304_4912 202
6 3300042615 Ga0466711_236630 Ga0466711_236630_6027_6641 204
7 3300042597 Ga0466699_124527 Ga0466699_124527_2889_3509 206
8 3300042607 Ga0466720_204731 Ga0466720_204731_809_1432 207
9 3300002450 JGI24695J34938_10007951 JGI24695J34938_100079518 208
10 3300024493 Ga0264413_115575 Ga0264413_1155752 209
11 3300042598 Ga0466701_043303 Ga0466701_043303_356_1030 209
12 3300042617 Ga0466718_121783 Ga0466718_121783_1097_1771 209
13 3300042592 Ga0466693_232206 Ga0466693_232206_3180_3872 210
14 3300002509 JGI24699J35502_11133422 JGI24699J35502_111334227 211
15 3300005201 Ga0072941_1033526 Ga0072941_10335261 211
16 3300042614 Ga0466712_096463 Ga0466712_096463_141_776 211
17 3300005200 Ga0072940_1049372 Ga0072940_10493724 213
18 3300009784 Ga0123357_10007038 Ga0123357_1000703811 213
19 3300002449 JGI24698J34947_10076476 JGI24698J34947_100764762 214
20 3300010882 Ga0123354_10194487 Ga0123354_101944872 214
21 3300042597 Ga0466699_409379 Ga0466699_409379_24_668 214
22 3300042614 Ga0466712_020533 Ga0466712_020533_1424_2068 214
23 3300042605 Ga0466716_159875 Ga0466716_159875_2203_2895 215
24 3300042614 Ga0466712_256284 Ga0466712_256284_1815_2495 215
25 3300005083 Ga0068305_10118427 Ga0068305_101184272 220
26 3300002462 JGI24702J35022_10006772 JGI24702J35022_100067724 222
27 3300002462 JGI24702J35022_10217069 JGI24702J35022_102170692 222
28 3300042592 Ga0466693_026737 Ga0466693_026737_482_1153 223
29 3300042594 Ga0466694_391408 Ga0466694_391408_660_1331 223
30 3300042607 Ga0466720_070033 Ga0466720_070033_1560_2231 223
31 3300042617 Ga0466718_117961 Ga0466718_117961_44131_44802 223
32 3300042656 Ga0466732_239552 Ga0466732_239552_203_874 223
33 iso_pr_bacteria 2781125690 2781427636 223
34 3300000089 AustNasuHG_c1001635 AustNasuHG_10016354 224
35 3300002462 JGI24702J35022_10000370 JGI24702J35022_1000037015 224
36 3300010167 Ga0123353_10158144 Ga0123353_101581442 224
37 3300010882 Ga0123354_10134407 Ga0123354_101344071 224
38 3300024493 Ga0264413_114226 Ga0264413_1142267 224
39 3300042595 Ga0466695_331872 Ga0466695_331872_3525_4199 224
40 3300042597 Ga0466699_389694 Ga0466699_389694_441_1115 224
41 3300042607 Ga0466720_018621 Ga0466720_018621_282_956 224
42 3300042607 Ga0466720_021829 Ga0466720_021829_736_1410 224
43 3300042607 Ga0466720_238288 Ga0466720_238288_226_900 224
44 3300042614 Ga0466712_022492 Ga0466712_022492_7031_7705 224
45 3300042624 Ga0466735_154276 Ga0466735_154276_656_1372 224
46 3300000089 AustNasuHG_c1049519 AustNasuHG_10495192 225
47 3300002449 JGI24698J34947_10034000 JGI24698J34947_100340001 225
48 3300042597 Ga0466699_000881 Ga0466699_000881_4253_4930 225
49 3300042597 Ga0466699_090943 Ga0466699_090943_6541_7218 225
50 3300042597 Ga0466699_336212 Ga0466699_336212_3274_3951 225
51 3300042614 Ga0466712_028136 Ga0466712_028136_11590_12267 225
52 3300042614 Ga0466712_094137 Ga0466712_094137_1244_1921 225
53 iso_pr_bacteria 2781125691 2781429519 225
54 3300002449 JGI24698J34947_10002864 JGI24698J34947_100028642 226
55 3300002449 JGI24698J34947_10006701 JGI24698J34947_100067012 226
56 3300002449 JGI24698J34947_10012506 JGI24698J34947_100125062 226
57 3300002449 JGI24698J34947_10012666 JGI24698J34947_100126662 226
58 3300002449 JGI24698J34947_10012946 JGI24698J34947_100129463 226
59 3300002449 JGI24698J34947_10020616 JGI24698J34947_100206164 226
60 3300002449 JGI24698J34947_10023575 JGI24698J34947_100235753 226
61 3300002449 JGI24698J34947_10040850 JGI24698J34947_100408502 226
62 3300002449 JGI24698J34947_10076490 JGI24698J34947_100764902 226
63 3300002449 JGI24698J34947_10122677 JGI24698J34947_101226772 226
64 3300002509 JGI24699J35502_10823466 JGI24699J35502_108234662 226
65 3300042594 Ga0466694_406717 Ga0466694_406717_2641_3321 226
66 3300042609 Ga0466722_066150 Ga0466722_066150_1692_2372 226
67 3300042614 Ga0466712_060371 Ga0466712_060371_1360_2040 226
68 3300042614 Ga0466712_150205 Ga0466712_150205_4238_4918 226
69 3300042614 Ga0466712_303630 Ga0466712_303630_1499_2179 226
70 3300042615 Ga0466711_005599 Ga0466711_005599_4671_5351 226
71 3300042615 Ga0466711_098426 Ga0466711_098426_1141_1821 226
72 3300042616 Ga0466715_447333 Ga0466715_447333_102_782 226
73 3300042616 Ga0466715_527255 Ga0466715_527255_1082_1762 226
74 3300042636 Ga0466703_274618 Ga0466703_274618_162_842 226
75 3300042652 Ga0466708_143876 Ga0466708_143876_10315_10995 226
76 3300042652 Ga0466708_191945 Ga0466708_191945_101_781 226
77 3300042655 Ga0466727_093493 Ga0466727_093493_1497_2177 226
78 3300042656 Ga0466732_066182 Ga0466732_066182_1967_2647 226
79 3300002449 JGI24698J34947_10000299 JGI24698J34947_100002997 227
80 3300002449 JGI24698J34947_10016830 JGI24698J34947_100168304 227
81 3300002449 JGI24698J34947_10022882 JGI24698J34947_100228823 227
82 3300042594 Ga0466694_056243 Ga0466694_056243_998_1681 227
83 3300042601 Ga0466707_051365 Ga0466707_051365_130_813 227
84 3300042616 Ga0466715_399910 Ga0466715_399910_1121_1804 227
85 3300010049 Ga0123356_11224737 Ga0123356_112247371 228
86 3300042609 Ga0466722_211149 Ga0466722_211149_731_1417 228
87 3300042616 Ga0466715_519413 Ga0466715_519413_236_922 228
88 3300042592 Ga0466693_320726 Ga0466693_320726_479_1168 229
89 3300042624 Ga0466735_111076 Ga0466735_111076_4557_5246 229
90 iso_pr_bacteria 2781125639 2781286497 229
91 iso_pr_bacteria 2781125655 2781317422 229
92 3300002449 JGI24698J34947_10003268 JGI24698J34947_100032683 230
93 3300002449 JGI24698J34947_10023238 JGI24698J34947_100232383 230
94 3300005201 Ga0072941_1054271 Ga0072941_10542713 230
95 3300009826 Ga0123355_10001344 Ga0123355_1000134436 230
96 3300042622 Ga0466731_408828 Ga0466731_408828_1102_1794 230
97 3300005201 Ga0072941_1028723 Ga0072941_10287233 231
98 3300005201 Ga0072941_1143771 Ga0072941_11437712 231
99 3300038395 Ga0415639_094625 Ga0415639_094625_2299_3015 232
100 3300042599 Ga0466706_026793 Ga0466706_026793_12674_13372 232
101 3300009784 Ga0123357_10081443 Ga0123357_100814432 233
102 iso_pr_bacteria 2781125681 2781406841 234
103 3300002462 JGI24702J35022_10057485 JGI24702J35022_100574853 235
104 3300005201 Ga0072941_1004713 Ga0072941_10047138 235
105 3300005201 Ga0072941_1059563 Ga0072941_10595638 235
106 3300038395 Ga0415639_080371 Ga0415639_080371_1419_2135 238
107 3300042616 Ga0466715_220957 Ga0466715_220957_1321_2037 238
108 3300042601 Ga0466707_173783 Ga0466707_173783_289_1047 241
109 3300042606 Ga0466719_232270 Ga0466719_232270_1691_2437 248
110 iso_pr_bacteria 2781125632 2781269914 257

🧩 MSA Aligner

Download FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF02666 PS_Dcarbxylase Phosphatidylserine decarboxylase 82 250 0.91

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.