Protein Family IF11734
Metagenome
Isolate
124
Members
46
Samples
115
Scaffolds
234.72
Avg Length
Representative Sequence
- ID
- iso_pr_bacteria|2781125629|2781263867|
- Length
- 283 aa
- Sequence
- MNIIAFDTASDVFSIGLSIEGHKYSISVDSGQKHSELIMDAADTLLRLADIEKSSLNAVACMEGPGSFTGLRIGFSAAKGLALALDIPIIPVPTLDCMAYPLSFWPGMVLPVMDAKKNAFFTALYSQGSRISDYFDIESKQLINTIEATWSGYNQQPRPKGSGYVGSDRYGLYAGLTPLKQNLEFSQTAQRGGVLNPLANKNTSVPLLLVTGPAASMVQNALVEAFPGTVSCGIFHQGYVEGLLNLAIQNSIINKELLDFSVGPLYLRKSDAELTENMDIGNV
Sample Types
Isolate
7.3%
Metagenome
92.7%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Kalotermitidae
31.8%
Termitidae
31.8%
Unclassified
20.5%
Rhinotermitidae
9.1%
Termopsidae
6.8%
Taxonomy
Archaea
0
Bacteria
116
Eukaryota
0
Viruses
0
Unclassified
8
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2781125629 | Treponema sp. Nt197P3bin20 | Isolate | Unclassified |
| 2 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 3 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 4 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 5 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 6 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 7 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 8 | 2781125688 | Treponema sp. Lab288P4bin13 | Isolate | Unclassified |
| 9 | 2781125690 | Treponema sp. Th196P3bin63 | Isolate | Unclassified |
| 10 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 11 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 12 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 13 | 2781125663 | Treponema sp. Emb289P3bin135 | Isolate | Unclassified |
| 14 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 15 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 16 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 17 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 18 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 19 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 20 | 2781125666 | Treponema sp. Emb289P4bin7 | Isolate | Unclassified |
| 21 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 22 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 23 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 24 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 25 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 26 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 27 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 28 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 29 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 30 | 2781125692 | Treponema sp. Th196P3bin31 | Isolate | Unclassified |
| 31 | 3300005485 | Termite gut microbial communities from Costa Rica - P3 luminal contents | Metagenome | Termitidae |
| 32 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 33 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 34 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 35 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 36 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 37 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 38 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 39 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 40 | 2781125630 | Treponema sp. Nt197P3bin60 | Isolate | Unclassified |
| 41 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 42 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 43 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 44 | 2772190978 | Treponema sp. Nt197P3bin57 | Isolate | Unclassified |
| 45 | 2781125632 | Treponema sp. Co191P1bin87 | Isolate | Unclassified |
| 46 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466717_255221 | 3300042604 | Bacteria | 1162 |
| 2 | Ga0466720_071777 | 3300042607 | Bacteria | 1923 |
| 3 | Ga0456237_0000442 | 3300041968 | Bacteria | 6272 |
| 4 | Ga0466694_098847 | 3300042594 | Bacteria | 2101 |
| 5 | Ga0466711_493444 | 3300042615 | Bacteria | 12498 |
| 6 | Ga0466715_303816 | 3300042616 | Bacteria | 14455 |
| 7 | Ga0466718_094808 | 3300042617 | Bacteria | 1666 |
| 8 | Ga0466729_173628 | 3300042621 | Bacteria | 1444 |
| 9 | Ga0466735_005997 | 3300042624 | Bacteria | 1650 |
| 10 | Ga0466735_100953 | 3300042624 | Bacteria | 12211 |
| 11 | Ga0466704_075068 | 3300042643 | Bacteria | 5890 |
| 12 | Ga0466704_151403 | 3300042643 | Bacteria | 8410 |
| 13 | Ga0466704_319704 | 3300042643 | Unclassified | 1145 |
| 14 | Ga0466704_507762 | 3300042643 | Bacteria | 3186 |
| 15 | Ga0466708_126911 | 3300042652 | Bacteria | 11037 |
| 16 | Ga0123357_10010866 | 3300009784 | Bacteria | 11618 |
| 17 | Ga0123353_10033662 | 3300010167 | Bacteria | 7983 |
| 18 | Ga0466716_233156 | 3300042605 | Bacteria | 8465 |
| 19 | Ga0466720_172233 | 3300042607 | Bacteria | 1624 |
| 20 | Ga0466691_144386 | 3300042593 | Bacteria | 3648 |
| 21 | Ga0466715_018604 | 3300042616 | Bacteria | 5859 |
| 22 | Ga0466718_020021 | 3300042617 | Bacteria | 4635 |
| 23 | Ga0466718_029019 | 3300042617 | Bacteria | 14475 |
| 24 | Ga0466718_167744 | 3300042617 | Bacteria | 22582 |
| 25 | Ga0466723_371734 | 3300042618 | Bacteria | 3825 |
| 26 | Ga0466735_028151 | 3300042624 | Bacteria | 4776 |
| 27 | Ga0466703_103003 | 3300042636 | Bacteria | 3965 |
| 28 | Ga0466704_309770 | 3300042643 | Bacteria | 2311 |
| 29 | Ga0466704_385519 | 3300042643 | Bacteria | 14620 |
| 30 | Ga0466708_134603 | 3300042652 | Bacteria | 10617 |
| 31 | Ga0466708_284234 | 3300042652 | Bacteria | 1324 |
| 32 | Ga0123356_11295118 | 3300010049 | Unclassified | 892 |
| 33 | Ga0466716_258827 | 3300042605 | Bacteria | 6892 |
| 34 | Ga0264413_113909 | 3300024493 | Bacteria | 5574 |
| 35 | Ga0456237_0015470 | 3300041968 | Bacteria | 1082 |
| 36 | Ga0466690_094882 | 3300042590 | Bacteria | 3781 |
| 37 | Ga0466693_303364 | 3300042592 | Bacteria | 5038 |
| 38 | Ga0466691_036248 | 3300042593 | Bacteria | 5971 |
| 39 | Ga0466705_081526 | 3300042612 | Bacteria | 18370 |
| 40 | Ga0466715_316631 | 3300042616 | Bacteria | 13080 |
| 41 | Ga0466723_098518 | 3300042618 | Bacteria | 16220 |
| 42 | Ga0466726_072713 | 3300042619 | Bacteria | 32187 |
| 43 | Ga0466726_369480 | 3300042619 | Bacteria | 1802 |
| 44 | Ga0466704_436359 | 3300042643 | Bacteria | 15554 |
| 45 | Ga0466727_233815 | 3300042655 | Bacteria | 1141 |
| 46 | Ga0466727_296319 | 3300042655 | Bacteria | 5673 |
| 47 | Ga0123357_10010824 | 3300009784 | Bacteria | 11640 |
| 48 | Ga0123353_10610536 | 3300010167 | Bacteria | 1556 |
| 49 | Ga0466719_096590 | 3300042606 | Bacteria | 13723 |
| 50 | Ga0466719_263457 | 3300042606 | Bacteria | 8892 |
| 51 | Ga0456237_0015181 | 3300041968 | Bacteria | 1093 |
| 52 | Ga0466691_025034 | 3300042593 | Bacteria | 2820 |
| 53 | Ga0466691_064907 | 3300042593 | Bacteria | 9360 |
| 54 | Ga0466715_200891 | 3300042616 | Bacteria | 1338 |
| 55 | Ga0466735_235353 | 3300042624 | Bacteria | 1693 |
| 56 | Ga0466703_216231 | 3300042636 | Bacteria | 14124 |
| 57 | Ga0466704_044703 | 3300042643 | Bacteria | 12056 |
| 58 | Ga0466704_108316 | 3300042643 | Bacteria | 5905 |
| 59 | Ga0466708_089882 | 3300042652 | Bacteria | 12910 |
| 60 | Ga0123354_10130368 | 3300010882 | Unclassified | 3180 |
| 61 | JGI24702J35022_10133421 | 3300002462 | Bacteria | 1380 |
| 62 | Ga0072941_1015195 | 3300005201 | Bacteria | 11371 |
| 63 | Ga0466716_022043 | 3300042605 | Bacteria | 17765 |
| 64 | Ga0466722_245636 | 3300042609 | Bacteria | 10743 |
| 65 | Ga0466698_363704 | 3300042610 | Bacteria | 4711 |
| 66 | Ga0466692_151134 | 3300042591 | Bacteria | 11495 |
| 67 | Ga0466691_155341 | 3300042593 | Bacteria | 8143 |
| 68 | Ga0466705_303719 | 3300042612 | Bacteria | 2112 |
| 69 | Ga0466712_304386 | 3300042614 | Bacteria | 1856 |
| 70 | Ga0466711_044091 | 3300042615 | Bacteria | 1374 |
| 71 | Ga0466718_032117 | 3300042617 | Bacteria | 1128 |
| 72 | Ga0466718_111890 | 3300042617 | Bacteria | 1005 |
| 73 | Ga0466703_037720 | 3300042636 | Bacteria | 12133 |
| 74 | Ga0466703_146267 | 3300042636 | Bacteria | 24001 |
| 75 | Ga0466704_200188 | 3300042643 | Bacteria | 9248 |
| 76 | Ga0466709_102555 | 3300042648 | Bacteria | 1553 |
| 77 | Ga0123356_10008342 | 3300010049 | Bacteria | 10306 |
| 78 | Ga0123356_10609100 | 3300010049 | Unclassified | 1257 |
| 79 | Ga0072941_1007278 | 3300005201 | Bacteria | 12191 |
| 80 | Ga0074263_110625 | 3300005485 | Bacteria | 1444 |
| 81 | Ga0466719_002643 | 3300042606 | Bacteria | 4440 |
| 82 | Ga0466719_500423 | 3300042606 | Bacteria | 1570 |
| 83 | Ga0466722_060288 | 3300042609 | Bacteria | 6715 |
| 84 | Ga0466696_472175 | 3300042596 | Bacteria | 6488 |
| 85 | Ga0466705_384978 | 3300042612 | Bacteria | 2318 |
| 86 | Ga0466705_414422 | 3300042612 | Bacteria | 10435 |
| 87 | Ga0466711_176289 | 3300042615 | Bacteria | 15324 |
| 88 | Ga0466715_202083 | 3300042616 | Unclassified | 2349 |
| 89 | Ga0466726_213819 | 3300042619 | Unclassified | 1064 |
| 90 | Ga0466728_026590 | 3300042620 | Bacteria | 1499 |
| 91 | Ga0466708_170404 | 3300042652 | Bacteria | 4071 |
| 92 | Ga0466708_203914 | 3300042652 | Bacteria | 12623 |
| 93 | Ga0466708_368278 | 3300042652 | Bacteria | 10878 |
| 94 | Ga0072940_1368848 | 3300005200 | Unclassified | 839 |
| 95 | Ga0072941_1007276 | 3300005201 | Bacteria | 15345 |
| 96 | Ga0466719_222229 | 3300042606 | Bacteria | 10737 |
| 97 | Ga0466720_048677 | 3300042607 | Bacteria | 2462 |
| 98 | Ga0466692_018590 | 3300042591 | Bacteria | 6788 |
| 99 | Ga0466691_064781 | 3300042593 | Bacteria | 7911 |
| 100 | Ga0466694_043554 | 3300042594 | Bacteria | 14346 |
| 101 | Ga0466715_033365 | 3300042616 | Bacteria | 10315 |
| 102 | Ga0466723_039951 | 3300042618 | Unclassified | 5224 |
| 103 | Ga0466723_272933 | 3300042618 | Bacteria | 2079 |
| 104 | Ga0466708_118785 | 3300042652 | Bacteria | 9449 |
| 105 | Ga0072941_1001996 | 3300005201 | Bacteria | 50262 |
| 106 | Ga0466720_014516 | 3300042607 | Bacteria | 1480 |
| 107 | Ga0466722_184391 | 3300042609 | Bacteria | 2154 |
| 108 | Ga0466692_013015 | 3300042591 | Bacteria | 22521 |
| 109 | Ga0466705_254772 | 3300042612 | Bacteria | 5637 |
| 110 | Ga0466705_323295 | 3300042612 | Bacteria | 3123 |
| 111 | Ga0466715_044002 | 3300042616 | Bacteria | 7442 |
| 112 | Ga0466726_035423 | 3300042619 | Bacteria | 2219 |
| 113 | Ga0466703_335018 | 3300042636 | Bacteria | 1420 |
| 114 | Ga0466709_210797 | 3300042648 | Bacteria | 29542 |
| 115 | JGI24702J35022_10194527 | 3300002462 | Bacteria | 1158 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00814 | TsaD | tRNA N6-adenosine threonylcarbamoyltransferase | 32 | 131 | 0.87 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.