Protein Family IF11696
Metagenome
Isolate
148
Members
48
Samples
140
Scaffolds
263.14
Avg Length
Representative Sequence
- ID
- iso_pr_bacteria|2772190889|2773431649|
- Length
- 310 aa
- Sequence
- MLPVIVVLVFFAVIFVASSIVIIRQYEKGLIETLGKYSGTRSSGPNIIVPIFQRIIRVDMRERVIDVPPQSVITKDNVSVVVDAIIYFQVTDPVKVVYNIENFALAALKLAQTNLRNVIGDMELDSTLTARGKINAQLREVMDEATDKWGVKVTRVEIQKIDPPRDITDSMSKQMKAEREKRANILEAEGLRQAAILKAEGAKQAVILEAEAMKEKQVLEATGQAEAIKKVADAEKYQIEIVYSAIHAGNPTNDLIAVKYLEALGKVADGQATKIFLPLETAGVTASIGGVAELFKDPSKIAKAISADKK
Sample Types
Isolate
5.4%
Metagenome
94.6%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
31.2%
Kalotermitidae
29.2%
Unclassified
22.9%
Termopsidae
8.3%
Rhinotermitidae
6.2%
Hodotermitidae
2.1%
Taxonomy
Archaea
0
Bacteria
117
Eukaryota
0
Viruses
0
Unclassified
31
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2772190891 | Unclassified Elusimicrobia Emb289P1_bin41 | Isolate | Unclassified |
| 2 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 3 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 4 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 5 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 6 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 7 | 2820950349 | Unclassified Acidobacteria Lab288P3bin89 | Isolate | Unclassified |
| 8 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 9 | 642555172 | Endomicrobium trichonymphae Rs-D17 | Isolate | Unclassified |
| 10 | 2772190892 | Unclassified Elusimicrobia Lab288P3_bin37 | Isolate | Unclassified |
| 11 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 12 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 13 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 14 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 15 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 16 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 17 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 18 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 19 | 2754412482 | Unclassified Elusimicrobia Emb289P3bin85 | Isolate | Unclassified |
| 20 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 21 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 22 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 23 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 24 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 25 | 2861449170 | Desulfovibrio intestinalis DSM 11275 | Isolate | Unclassified |
| 26 | 2820044805 | Unclassified Proteobacteria Th196P4bin15 | Isolate | Unclassified |
| 27 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 28 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 29 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 30 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 31 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 32 | 2772190889 | Unclassified Elusimicrobia Cu122P5_bin43 | Isolate | Unclassified |
| 33 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 34 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 35 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 36 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 37 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 38 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 39 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 40 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 41 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 42 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 43 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 44 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 45 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 46 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 47 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 48 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466711_511332 | 3300042615 | Bacteria | 1214 |
| 2 | Ga0466728_134295 | 3300042620 | Bacteria | 11818 |
| 3 | Ga0466728_394234 | 3300042620 | Unclassified | 14980 |
| 4 | Ga0466690_137309 | 3300042590 | Bacteria | 4038 |
| 5 | Ga0466691_150879 | 3300042593 | Unclassified | 4528 |
| 6 | Ga0466735_003950 | 3300042624 | Unclassified | 10110 |
| 7 | Ga0466735_037671 | 3300042624 | Bacteria | 6840 |
| 8 | Ga0466735_122327 | 3300042624 | Bacteria | 18290 |
| 9 | Ga0466709_405840 | 3300042648 | Bacteria | 15583 |
| 10 | Ga0466706_010205 | 3300042599 | Bacteria | 97987 |
| 11 | Ga0466706_037575 | 3300042599 | Bacteria | 87054 |
| 12 | Ga0466713_099642 | 3300042602 | Bacteria | 24894 |
| 13 | Ga0466714_002903 | 3300042603 | Bacteria | 22685 |
| 14 | Ga0466698_295840 | 3300042610 | Bacteria | 3373 |
| 15 | JGI24702J35022_10005169 | 3300002462 | Unclassified | 7656 |
| 16 | Ga0068302_10008740 | 3300005071 | Bacteria | 10277 |
| 17 | Ga0466711_065300 | 3300042615 | Bacteria | 112913 |
| 18 | Ga0466711_186304 | 3300042615 | Bacteria | 8882 |
| 19 | Ga0466711_192771 | 3300042615 | Unclassified | 6371 |
| 20 | Ga0466728_380833 | 3300042620 | Bacteria | 49387 |
| 21 | Ga0466729_068122 | 3300042621 | Bacteria | 10181 |
| 22 | Ga0466690_377853 | 3300042590 | Bacteria | 1217 |
| 23 | Ga0466691_004916 | 3300042593 | Unclassified | 3197 |
| 24 | Ga0466735_047591 | 3300042624 | Unclassified | 5634 |
| 25 | Ga0466704_004355 | 3300042643 | Bacteria | 5473 |
| 26 | Ga0466704_167270 | 3300042643 | Bacteria | 32596 |
| 27 | Ga0466706_148071 | 3300042599 | Bacteria | 16150 |
| 28 | Ga0466706_217033 | 3300042599 | Bacteria | 132615 |
| 29 | Ga0466706_254954 | 3300042599 | Bacteria | 21529 |
| 30 | Ga0466707_360682 | 3300042601 | Bacteria | 24713 |
| 31 | Ga0466707_362795 | 3300042601 | Bacteria | 8281 |
| 32 | Ga0466719_127211 | 3300042606 | Bacteria | 279481 |
| 33 | JGI24702J35022_10053380 | 3300002462 | Bacteria | 2156 |
| 34 | JGI24696J40584_12930044 | 3300002834 | Bacteria | 1463 |
| 35 | Ga0068305_10000079 | 3300005083 | Bacteria | 163717 |
| 36 | Ga0123353_10000902 | 3300010167 | Unclassified | 36219 |
| 37 | Ga0466711_408074 | 3300042615 | Bacteria | 10359 |
| 38 | Ga0466723_097650 | 3300042618 | Bacteria | 5344 |
| 39 | Ga0466726_217236 | 3300042619 | Bacteria | 220873 |
| 40 | Ga0466728_427667 | 3300042620 | Bacteria | 41368 |
| 41 | Ga0466729_185786 | 3300042621 | Bacteria | 54149 |
| 42 | Ga0466694_236279 | 3300042594 | Bacteria | 3046 |
| 43 | Ga0466735_008330 | 3300042624 | Bacteria | 38328 |
| 44 | Ga0466735_131186 | 3300042624 | Bacteria | 6907 |
| 45 | Ga0466727_195812 | 3300042655 | Bacteria | 6735 |
| 46 | Ga0466713_115381 | 3300042602 | Bacteria | 78358 |
| 47 | Ga0466713_123047 | 3300042602 | Bacteria | 2020 |
| 48 | Ga0466716_342092 | 3300042605 | Bacteria | 4769 |
| 49 | Ga0466719_127487 | 3300042606 | Bacteria | 8578 |
| 50 | Ga0466719_130653 | 3300042606 | Bacteria | 158630 |
| 51 | Ga0068302_10020953 | 3300005071 | Unclassified | 6953 |
| 52 | Ga0068305_10000140 | 3300005083 | Bacteria | 37543 |
| 53 | Ga0068305_10000274 | 3300005083 | Bacteria | 30353 |
| 54 | Ga0466705_048392 | 3300042612 | Bacteria | 1569 |
| 55 | Ga0466705_284782 | 3300042612 | Bacteria | 31117 |
| 56 | Ga0123356_10000069 | 3300010049 | Bacteria | 108106 |
| 57 | Ga0123356_10000716 | 3300010049 | Bacteria | 36801 |
| 58 | Ga0466710_025697 | 3300042613 | Bacteria | 11764 |
| 59 | Ga0466715_005134 | 3300042616 | Bacteria | 2561 |
| 60 | Ga0466726_214600 | 3300042619 | Bacteria | 58941 |
| 61 | Ga0466726_218302 | 3300042619 | Bacteria | 1681 |
| 62 | Ga0466729_020210 | 3300042621 | Bacteria | 38709 |
| 63 | Ga0466692_176542 | 3300042591 | Bacteria | 2745 |
| 64 | Ga0466696_377217 | 3300042596 | Unclassified | 13142 |
| 65 | Ga0466709_066348 | 3300042648 | Bacteria | 39651 |
| 66 | Ga0466708_347024 | 3300042652 | Bacteria | 31983 |
| 67 | Ga0466727_330892 | 3300042655 | Unclassified | 4042 |
| 68 | Ga0466707_307607 | 3300042601 | Bacteria | 28198 |
| 69 | Ga0466713_070887 | 3300042602 | Bacteria | 102768 |
| 70 | Ga0466716_545394 | 3300042605 | Bacteria | 1136 |
| 71 | Ga0068305_10020929 | 3300005083 | Bacteria | 6121 |
| 72 | Ga0466732_291219 | 3300042656 | Bacteria | 9790 |
| 73 | Ga0123353_10292862 | 3300010167 | Unclassified | 2491 |
| 74 | Ga0466711_117944 | 3300042615 | Bacteria | 215972 |
| 75 | Ga0466711_214817 | 3300042615 | Unclassified | 7899 |
| 76 | Ga0466715_436492 | 3300042616 | Bacteria | 169505 |
| 77 | Ga0466715_613120 | 3300042616 | Bacteria | 1650 |
| 78 | Ga0466726_010951 | 3300042619 | Bacteria | 7533 |
| 79 | Ga0466690_084823 | 3300042590 | Unclassified | 13016 |
| 80 | Ga0466729_198612 | 3300042621 | Bacteria | 122910 |
| 81 | Ga0466729_205530 | 3300042621 | Bacteria | 1688 |
| 82 | Ga0466703_395188 | 3300042636 | Bacteria | 299836 |
| 83 | Ga0466704_104849 | 3300042643 | Bacteria | 5278 |
| 84 | Ga0466704_427282 | 3300042643 | Bacteria | 1871 |
| 85 | Ga0466727_271147 | 3300042655 | Bacteria | 176023 |
| 86 | Ga0466713_056922 | 3300042602 | Bacteria | 3443 |
| 87 | Ga0466719_068744 | 3300042606 | Bacteria | 48898 |
| 88 | Ga0466705_143986 | 3300042612 | Bacteria | 113378 |
| 89 | Ga0123355_10238117 | 3300009826 | Unclassified | 2584 |
| 90 | Ga0123353_10056533 | 3300010167 | Bacteria | 6280 |
| 91 | Ga0466711_152179 | 3300042615 | Unclassified | 19214 |
| 92 | Ga0466711_427370 | 3300042615 | Bacteria | 90157 |
| 93 | Ga0466715_191600 | 3300042616 | Bacteria | 6853 |
| 94 | Ga0466723_106583 | 3300042618 | Bacteria | 10042 |
| 95 | Ga0466729_009144 | 3300042621 | Bacteria | 3660 |
| 96 | Ga0466692_093889 | 3300042591 | Bacteria | 9334 |
| 97 | Ga0466703_158285 | 3300042636 | Bacteria | 84792 |
| 98 | Ga0466704_009076 | 3300042643 | Bacteria | 2743 |
| 99 | Ga0466704_440731 | 3300042643 | Unclassified | 36701 |
| 100 | Ga0466709_266294 | 3300042648 | Bacteria | 9331 |
| 101 | Ga0466708_038980 | 3300042652 | Bacteria | 16274 |
| 102 | Ga0466706_166478 | 3300042599 | Bacteria | 103376 |
| 103 | Ga0466707_078534 | 3300042601 | Bacteria | 53059 |
| 104 | Ga0466707_308312 | 3300042601 | Bacteria | 8470 |
| 105 | Ga0466707_311805 | 3300042601 | Bacteria | 94534 |
| 106 | Ga0466716_022606 | 3300042605 | Bacteria | 12385 |
| 107 | Ga0466722_177440 | 3300042609 | Bacteria | 34429 |
| 108 | Ga0072940_1080546 | 3300005200 | Bacteria | 9882 |
| 109 | Ga0466705_382719 | 3300042612 | Bacteria | 57295 |
| 110 | Ga0466711_182012 | 3300042615 | Unclassified | 9050 |
| 111 | Ga0466715_199189 | 3300042616 | Bacteria | 10946 |
| 112 | Ga0466715_318153 | 3300042616 | Unclassified | 7026 |
| 113 | Ga0466718_054877 | 3300042617 | Bacteria | 1160 |
| 114 | Ga0466735_202470 | 3300042624 | Bacteria | 8131 |
| 115 | Ga0466704_013417 | 3300042643 | Unclassified | 2346 |
| 116 | Ga0466708_241765 | 3300042652 | Unclassified | 1550 |
| 117 | Ga0466727_203476 | 3300042655 | Bacteria | 22578 |
| 118 | Ga0466727_298426 | 3300042655 | Bacteria | 81478 |
| 119 | JGI24702J35022_10024259 | 3300002462 | Unclassified | 3277 |
| 120 | Ga0068305_10000924 | 3300005083 | Unclassified | 65035 |
| 121 | Ga0466705_387052 | 3300042612 | Unclassified | 29888 |
| 122 | Ga0123357_10012410 | 3300009784 | Bacteria | 10993 |
| 123 | Ga0466711_448087 | 3300042615 | Bacteria | 2672 |
| 124 | Ga0466715_026286 | 3300042616 | Bacteria | 37068 |
| 125 | Ga0466715_306223 | 3300042616 | Bacteria | 28309 |
| 126 | Ga0466723_000695 | 3300042618 | Unclassified | 1898 |
| 127 | Ga0466723_042388 | 3300042618 | Bacteria | 7228 |
| 128 | Ga0466726_275868 | 3300042619 | Unclassified | 2964 |
| 129 | Ga0466726_284750 | 3300042619 | Unclassified | 20964 |
| 130 | Ga0466726_462755 | 3300042619 | Bacteria | 24529 |
| 131 | Ga0466690_039786 | 3300042590 | Bacteria | 31557 |
| 132 | Ga0466691_010657 | 3300042593 | Unclassified | 5034 |
| 133 | Ga0466734_059179 | 3300042623 | Bacteria | 2964 |
| 134 | Ga0466735_001817 | 3300042624 | Bacteria | 8959 |
| 135 | Ga0466702_089902 | 3300042635 | Unclassified | 1315 |
| 136 | Ga0466703_110964 | 3300042636 | Bacteria | 165564 |
| 137 | Ga0466704_021170 | 3300042643 | Unclassified | 2343 |
| 138 | Ga0466708_422468 | 3300042652 | Unclassified | 15330 |
| 139 | Ga0466706_152737 | 3300042599 | Bacteria | 7283 |
| 140 | Ga0466722_080002 | 3300042609 | Bacteria | 1579 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF01145 | Band_7 | SPFH domain / Band 7 family | 22 | 190 | 0.98 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.