Protein Family IF11386
Metagenome
Isolate
212
Members
149
Samples
123
Scaffolds
330.65
Avg Length
Representative Sequence
- ID
- iso_pr_bacteria|2724678956|2724788701|
- Length
- 362 aa
- Sequence
- MDAAKEPAKDASSSQPQVASPEAGSSQAVEAHKPAPNMPQFTRAEDLHAYHEMLLIRRFEEKAGQLYGMGLIGGFCHLYIGQEAVVIGMQMASIDGDQVITGYRDHGHMLACGMDPKGVMAELTGRRGGYSRGKGGSMHMFSREKQFFGGHGIVGAQVSLGTGLAFADHYRENGKVSLTYMGDGAANQGQVYESFNMAALWKLPVVYVIENNRYAMGTSVARASAQTDFSKRGISFGIPGEQVDGMDVRTVREAAARAVEHARSGQGPYILEMQTYRYRGHSMSDPAKYRTKDEVSKMRDEHDPIEMVRKRLIELHGVPEAEIKATDAKVRETVNAAAEFATNDPEPDPAELWTDILLDAHA
Sample Types
Isolate
42.0%
Metagenome
58.0%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Drosophilidae
25.9%
Unclassified
15.0%
Termitidae
10.9%
Kalotermitidae
9.5%
Formicidae
8.2%
Apidae
8.2%
Elmidae
4.8%
Blattidae
3.4%
Armadillidiidae
2.7%
Culicidae
2.7%
Termopsidae
2.0%
Rhinotermitidae
2.0%
Nephropidae
1.4%
Ixodidae
1.4%
Muscidae
0.7%
Ceratopogonidae
0.7%
Tenebrionidae
0.7%
Taxonomy
Archaea
0
Bacteria
201
Eukaryota
0
Viruses
0
Unclassified
11
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2617271320 | Acetobacter pomorum DmCS_004 | Isolate | Drosophilidae |
| 2 | 2724678956 | Methylobacterium sp. GXS13 | Isolate | Unclassified |
| 3 | 2839192570 | Gluconobacter sp. DsW_056 | Isolate | Drosophilidae |
| 4 | 2839785767 | Thalassobius sp. I31.1 | Isolate | Nephropidae |
| 5 | 2854518031 | Acetobacter indonesiensis DmW_046 | Isolate | Drosophilidae |
| 6 | 3300002938 | Larval gut metagenome for colony PL005 | Metagenome | Formicidae |
| 7 | 3300029809 | Ant gut bacterial community from Dolichoderus sp. 3-PL2018, Madre de Dios, Puerto Maldonado, Peru - colony JSC188 | Metagenome | Formicidae |
| 8 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 9 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 10 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 11 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 12 | 2718218026 | Phaeobacter porticola P97 | Isolate | Unclassified |
| 13 | 2751185679 | Parasaccharibacter apium G7_7_3c | Isolate | Apidae |
| 14 | 2820501819 | Unclassified Firmicutes Lab288P1bin51 | Isolate | Unclassified |
| 15 | 2831736028 | Parasaccharibacter apium A29 | Isolate | Apidae |
| 16 | 2834852038 | Acetobacter cibinongensis DsW_47 | Isolate | Drosophilidae |
| 17 | 2841330038 | Sulfitobacter sp. D7 | Isolate | |
| 18 | 2858105562 | Acetobacter sp. DsW_059 | Isolate | Drosophilidae |
| 19 | 2864934081 | Brevundimonas vesicularis S00192 | Isolate | Elmidae |
| 20 | 2864993140 | Agrobacterium vitis S00303 | Isolate | Elmidae |
| 21 | 2900132049 | Bartonella massiliensis OS09 | Isolate | Unclassified |
| 22 | 3002401049 | Gluconobacter sp. Dm-62 | Isolate | Drosophilidae |
| 23 | 3300007067 | Ant gut microbial communities from Cephalotes spinosus, Peru | Metagenome | Formicidae |
| 24 | 3300007763 | Drosophila gut microbial communities from New York, USA - Drosophila suzukii female 5 gut | Metagenome | Drosophilidae |
| 25 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 26 | 3300012820 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E6 MG | Metagenome | Armadillidiidae |
| 27 | 3300012845 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E6 MG | Metagenome | Culicidae |
| 28 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 29 | 8067483258 | Ochrobactrum soli MTP-C0764 | Isolate | Muscidae |
| 30 | 8067585538 | Gluconobacter kondonii Dm-68 | Isolate | Drosophilidae |
| 31 | 8074812948 | Bombella apis MRM1 | Isolate | Apidae |
| 32 | 2711768164 | Tritonibacter mobilis S1942 | Isolate | Unclassified |
| 33 | 2816332478 | Acetobacter tropicalis BDGP1 | Isolate | Drosophilidae |
| 34 | 2816332545 | Tritonibacter mobilis S1923 | Isolate | Unclassified |
| 35 | 2820146621 | Unclassified Proteobacteria Emb289P3bin103 | Isolate | Unclassified |
| 36 | 2843864159 | Acetobacter pomorum SH | Isolate | Drosophilidae |
| 37 | 2854540230 | Acetobacter sp. DsW_063 | Isolate | Drosophilidae |
| 38 | 2864951976 | Brevundimonas bullata S00223 | Isolate | Elmidae |
| 39 | 2868677537 | Acetobacter orientalis DsW_061 | Isolate | Drosophilidae |
| 40 | 2920412021 | Bombella sp. ESL0387 | Isolate | Apidae |
| 41 | 3002394112 | Gluconobacter sp. Gdi | Isolate | Drosophilidae |
| 42 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 43 | 3300028918 | Ant gut bacterial community from Dolichoderus sp. 2-PL2018, Madre de Dios, Puerto Maldonado, Peru - colony JSC085 | Metagenome | Formicidae |
| 44 | 3300029810 | Ant gut bacterial community from Dolichoderus sp. 4-PL2018, Madre de Dios, Puerto Maldonado, Peru - colony JSC189 | Metagenome | Formicidae |
| 45 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 46 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 47 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 48 | 651324000 | Acetobacter pomorum DM001 | Isolate | Drosophilidae |
| 49 | 8067588748 | Gluconobacter kondonii Dm-42 | Isolate | Drosophilidae |
| 50 | 8074809037 | Bombella apis MRM1 | Isolate | Apidae |
| 51 | 639279308 | Ehrlichia ruminantium Welgevonden, ARC-OVI | Isolate | Unclassified |
| 52 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 53 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 54 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 55 | 2619619079 | Sphingomonas sp. Mn802worker | Isolate | Termitidae |
| 56 | 2681813507 | Insolitispirillum peregrinum integrum DSM 11589 | Isolate | Unclassified |
| 57 | 2786546124 | Acetobacter sp. JWB | Isolate | Drosophilidae |
| 58 | 2585427698 | Occidentia massiliensis OS118 | Isolate | Unclassified |
| 59 | 2854520951 | Acetobacter pasteurianus AD | Isolate | Unclassified |
| 60 | 2854536247 | Acetobacter senegalensis DmL_050 | Isolate | Drosophilidae |
| 61 | 2858102877 | Acetobacter orientalis DmW_048 | Isolate | Drosophilidae |
| 62 | 2858129007 | Acetobacter orientalis DmW_045 | Isolate | Drosophilidae |
| 63 | 2864866972 | Brevundimonas bullata S00123 | Isolate | Elmidae |
| 64 | 2940270707 | Lachnoclostridium sp. PF1-13 | Isolate | Blattidae |
| 65 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 66 | 3300012812 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E11 MG | Metagenome | Culicidae |
| 67 | 3300012819 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E11 MG | Metagenome | Armadillidiidae |
| 68 | 3300028910 | Ant gut bacterial community from Dolichoderus sp. 1-PL2018, Madre de Dios, Puerto Maldonado, Peru - colony JSC161 | Metagenome | Formicidae |
| 69 | 8067591850 | Gluconobacter kondonii Dm-47 | Isolate | Drosophilidae |
| 70 | 8100528075 | Gluconobacter sp. Dm-44 | Isolate | Drosophilidae |
| 71 | 639279309 | Ehrlichia ruminantium Welgevonden, CIRAD | Isolate | Unclassified |
| 72 | 2791354941 | Bombella intestini R-52487 | Isolate | Unclassified |
| 73 | 2820234266 | Unclassified Firmicutes Th196P3bin99 | Isolate | Unclassified |
| 74 | 2834038347 | Gluconobacter sp. DsW_058 | Isolate | Drosophilidae |
| 75 | 2858084324 | Acetobacter sp. DsW_54 | Isolate | Drosophilidae |
| 76 | 2858119979 | Acetobacter malorum DsW_057 | Isolate | Drosophilidae |
| 77 | 2864955722 | Sphingomonas kyeonggiensis S00224 | Isolate | Elmidae |
| 78 | 2940273867 | Lachnoclostridium sp. PH1-16 | Isolate | Blattidae |
| 79 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 80 | 3300007129 | Ant gut microbial communities from Cephalotes atratus, Brazil | Metagenome | Formicidae |
| 81 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 82 | 8067604290 | Gluconobacter wancherniae Dm-19 | Isolate | Drosophilidae |
| 83 | 8067607133 | Gluconobacter wancherniae Dm-15 | Isolate | Drosophilidae |
| 84 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 85 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 86 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 87 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 88 | 2816332503 | Tritonibacter mobilis S1611 | Isolate | Unclassified |
| 89 | 2854548700 | Acetobacter persici DmL_053 | Isolate | Drosophilidae |
| 90 | 2868683769 | Acetobacter sp. DmW_043 | Isolate | Drosophilidae |
| 91 | 2873468275 | Agrobacterium vitis S00131 | Isolate | Elmidae |
| 92 | 3300012846 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG | Metagenome | Armadillidiidae |
| 93 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 94 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 95 | 8074810961 | Bombella apis SME1 | Isolate | Apidae |
| 96 | 8100534375 | Gluconobacter sp. Dm-74 | Isolate | Drosophilidae |
| 97 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 98 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 99 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 100 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 101 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 102 | 2556921622 | Terasakiella pusilla DSM 6293 | Isolate | Unclassified |
| 103 | 2597490292 | Acetobacter malorum DmCS_005 | Isolate | Drosophilidae |
| 104 | 2599185121 | Rickettsiales bacterium Ac37b | Isolate | Ixodidae |
| 105 | 2834143536 | Parasaccharibacter apium AS1 | Isolate | Apidae |
| 106 | 2834160066 | Parasaccharibacter apium B8 | Isolate | Apidae |
| 107 | 2834764525 | Rickettsia endosymbiont of Culicoides newsteadi RiCNE | Isolate | Ceratopogonidae |
| 108 | 2841175817 | Komagataeibacter saccharivorans JH1 | Isolate | Unclassified |
| 109 | 2864976888 | Novosphingobium chloroacetimidivorans S00245 | Isolate | Elmidae |
| 110 | 2899194184 | Bombella sp. ESL0378 | Isolate | Apidae |
| 111 | 2920413932 | Bombella sp. ESL0380 | Isolate | Apidae |
| 112 | 2940228231 | Anaerovoracaceae bacterium PM5-7 | Isolate | Blattidae |
| 113 | 3300007188 | Ant gut microbial communities from Cephalotes rohweri, Arizona, USA | Metagenome | Formicidae |
| 114 | 3300009460 | Microbial communities of aphids from Pistacia texana in Langtry, TX, USA - Geopemphigus sp. seqcov | Metagenome | |
| 115 | 3300012831 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E6 MG | Metagenome | Culicidae |
| 116 | 3300012835 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E1 MG | Metagenome | Culicidae |
| 117 | 8067594896 | Gluconobacter kondonii Dm-18 | Isolate | Drosophilidae |
| 118 | 8100531325 | Gluconobacter sp. Dm-73 | Isolate | Drosophilidae |
| 119 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 120 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 121 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 122 | 2744054723 | Ehrlichia ruminantium Palm River | Isolate | Unclassified |
| 123 | 2806310572 | Pukyongiella litopenaei SH-1 | Isolate | Unclassified |
| 124 | 2828301124 | Sphingomonas leidyi DSM 4733 | Isolate | Unclassified |
| 125 | 2834165886 | Saccharibacter sp. M18 | Isolate | Apidae |
| 126 | 2835143510 | Yoonia maritima YPC211 | Isolate | Nephropidae |
| 127 | 2854576727 | Acetobacter okinawensis DsW_060 | Isolate | Drosophilidae |
| 128 | 2858089842 | Acetobacter tropicalis DmW_042 | Isolate | Drosophilidae |
| 129 | 2858110640 | Acetobacter indonesiensis DmL_051 | Isolate | Drosophilidae |
| 130 | 2901819457 | Bombella sp. ESL0385 | Isolate | Apidae |
| 131 | 2940264388 | Lachnospiraceae bacterium PFB1-17 | Isolate | Blattidae |
| 132 | 2940267548 | Lachnospiraceae bacterium PFB1-22 | Isolate | Blattidae |
| 133 | 3300002931 | Ant worker gut metagenome for colony PL010 | Metagenome | Formicidae |
| 134 | 3300002934 | Ant worker gut metagenome for colony PL005 | Metagenome | Formicidae |
| 135 | 3300007052 | Ant gut microbial communities from Cephalotes eduarduli, Brazil | Metagenome | Formicidae |
| 136 | 3300007190 | Ant gut microbial communities from Cephalotes umbraculatus, Peru | Metagenome | Formicidae |
| 137 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 138 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 139 | 3300012829 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG | Metagenome | Armadillidiidae |
| 140 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 141 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 142 | 3300056564 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS_oats (Improved Draft) | Metagenome | Tenebrionidae |
| 143 | 8067579126 | Gluconobacter kondonii Dm-16 | Isolate | Drosophilidae |
| 144 | 8067581993 | Gluconobacter kondonii Dm-54 | Isolate | Drosophilidae |
| 145 | 8067598439 | Gluconobacter wancherniae Dm-17 | Isolate | Drosophilidae |
| 146 | 650716015 | Candidatus Midichloria mitochondrii IricVA | Isolate | Ixodidae |
| 147 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 148 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 149 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0123355_10002885 | 3300009826 | Bacteria | 24415 |
| 2 | Ga0123356_10038234 | 3300010049 | Unclassified | 4472 |
| 3 | Ga0123356_10043012 | 3300010049 | Bacteria | 4206 |
| 4 | Ga0068302_10127949 | 3300005071 | Bacteria | 3067 |
| 5 | Ga0102736_1005516 | 3300007052 | Bacteria | 1612 |
| 6 | Ga0160456_100004 | 3300012820 | Bacteria | 631412 |
| 7 | Ga0160433_100593 | 3300012846 | Bacteria | 15221 |
| 8 | Ga0415639_018703 | 3300038395 | Bacteria | 3914 |
| 9 | Ga0466707_352343 | 3300042601 | Bacteria | 2786 |
| 10 | Ga0466711_517693 | 3300042615 | Bacteria | 10474 |
| 11 | Ga0466715_029280 | 3300042616 | Bacteria | 24753 |
| 12 | Ga0466723_297882 | 3300042618 | Bacteria | 1511 |
| 13 | Ga0466728_157307 | 3300042620 | Unclassified | 5910 |
| 14 | Ga0466728_427273 | 3300042620 | Bacteria | 5706 |
| 15 | Ga0466703_105310 | 3300042636 | Bacteria | 64560 |
| 16 | Ga0466704_136556 | 3300042643 | Bacteria | 3834 |
| 17 | Ga0466704_415171 | 3300042643 | Bacteria | 1335 |
| 18 | Ga0466708_079679 | 3300042652 | Bacteria | 41277 |
| 19 | Ga0123357_10220084 | 3300009784 | Bacteria | 2108 |
| 20 | Ga0123353_10703606 | 3300010167 | Bacteria | 1417 |
| 21 | CVPL010W_10000046 | 3300002931 | Bacteria | 72984 |
| 22 | Ga0127649_101174 | 3300009460 | Bacteria | 51970 |
| 23 | Ga0466719_231803 | 3300042606 | Bacteria | 3094 |
| 24 | Ga0466705_417361 | 3300042612 | Unclassified | 38581 |
| 25 | Ga0466711_059535 | 3300042615 | Bacteria | 20049 |
| 26 | Ga0466705_238066 | 3300042612 | Bacteria | 6903 |
| 27 | Ga0466709_361306 | 3300042648 | Bacteria | 1414 |
| 28 | Ga0123356_10060404 | 3300010049 | Bacteria | 3537 |
| 29 | Ga0123353_10047725 | 3300010167 | Bacteria | 6813 |
| 30 | Ga0123353_10610755 | 3300010167 | Bacteria | 1556 |
| 31 | JGI24705J35276_12238790 | 3300002504 | Bacteria | 69628 |
| 32 | CVPL010W_10000242 | 3300002931 | Bacteria | 51431 |
| 33 | Ga0103264_1001271 | 3300007188 | Bacteria | 17688 |
| 34 | Ga0103267_1000011 | 3300007190 | Bacteria | 88011 |
| 35 | Ga0160468_100001 | 3300012819 | Bacteria | 1115787 |
| 36 | Ga0160459_100464 | 3300012831 | Bacteria | 15940 |
| 37 | Ga0466716_409557 | 3300042605 | Bacteria | 2246 |
| 38 | Ga0466719_515297 | 3300042606 | Bacteria | 4890 |
| 39 | Ga0466722_020859 | 3300042609 | Bacteria | 10979 |
| 40 | Ga0466726_392206 | 3300042619 | Bacteria | 32327 |
| 41 | Ga0466705_019481 | 3300042612 | Bacteria | 57905 |
| 42 | Ga0466705_170954 | 3300042612 | Bacteria | 1596 |
| 43 | Ga0466704_028795 | 3300042643 | Bacteria | 1465 |
| 44 | Ga0466704_564361 | 3300042643 | Bacteria | 4457 |
| 45 | Ga0466708_064335 | 3300042652 | Bacteria | 39210 |
| 46 | Ga0466725_194965 | 3300042654 | Bacteria | 3141 |
| 47 | Ga0466725_382118 | 3300042654 | Bacteria | 3721 |
| 48 | Ga0123355_10435328 | 3300009826 | Bacteria | 1665 |
| 49 | Ga0123356_10011207 | 3300010049 | Bacteria | 8754 |
| 50 | Ga0123356_10085909 | 3300010049 | Unclassified | 2985 |
| 51 | Ga0123356_10409095 | 3300010049 | Bacteria | 1496 |
| 52 | Ga0123353_10341683 | 3300010167 | Bacteria | 2261 |
| 53 | Ga0123353_10651536 | 3300010167 | Unclassified | 1491 |
| 54 | Ga0102736_1016141 | 3300007052 | Bacteria | 1455 |
| 55 | Ga0105004_1026207 | 3300007763 | Bacteria | 2385 |
| 56 | Ga0309902_000001 | 3300028910 | Bacteria | 348555 |
| 57 | Ga0309903_100005 | 3300029809 | Bacteria | 95692 |
| 58 | Ga0415639_094185 | 3300038395 | Bacteria | 2457 |
| 59 | Ga0466700_025103 | 3300042600 | Unclassified | 14818 |
| 60 | Ga0466700_398659 | 3300042600 | Bacteria | 2267 |
| 61 | Ga0466717_011898 | 3300042604 | Bacteria | 3188 |
| 62 | Ga0466734_015083 | 3300042623 | Bacteria | 2840 |
| 63 | Ga0466725_260301 | 3300042654 | Bacteria | 1640 |
| 64 | Ga0123356_10004876 | 3300010049 | Unclassified | 13788 |
| 65 | Ga0123356_10005398 | 3300010049 | Bacteria | 13016 |
| 66 | Ga0123356_10314038 | 3300010049 | Bacteria | 1678 |
| 67 | Ga0123353_10171169 | 3300010167 | Bacteria | 3447 |
| 68 | JGI24705J35276_12237491 | 3300002504 | Bacteria | 11388 |
| 69 | CVPL005L_10000001 | 3300002938 | Bacteria | 447235 |
| 70 | Ga0103266_1000028 | 3300007067 | Bacteria | 136279 |
| 71 | Ga0466692_133650 | 3300042591 | Bacteria | 13235 |
| 72 | Ga0466691_005964 | 3300042593 | Bacteria | 10019 |
| 73 | Ga0466696_078936 | 3300042596 | Bacteria | 4903 |
| 74 | Ga0466723_002252 | 3300042618 | Bacteria | 12443 |
| 75 | Ga0466708_102826 | 3300042652 | Bacteria | 39124 |
| 76 | Ga0530661_000807 | 3300056564 | Bacteria | 19847 |
| 77 | Ga0123353_10446041 | 3300010167 | Bacteria | 1907 |
| 78 | CVPL010W_10010189 | 3300002931 | Bacteria | 8236 |
| 79 | Ga0160433_100004 | 3300012846 | Bacteria | 543746 |
| 80 | Ga0309901_1000013 | 3300028918 | Bacteria | 346588 |
| 81 | Ga0309904_1000016 | 3300029810 | Bacteria | 70698 |
| 82 | Ga0466657_043659 | 3300042582 | Unclassified | 3645 |
| 83 | Ga0466657_165439 | 3300042582 | Bacteria | 6043 |
| 84 | Ga0466690_012460 | 3300042590 | Bacteria | 15225 |
| 85 | Ga0466707_303768 | 3300042601 | Bacteria | 21084 |
| 86 | Ga0466697_184761 | 3300042611 | Bacteria | 2180 |
| 87 | Ga0466705_172593 | 3300042612 | Unclassified | 4147 |
| 88 | Ga0466705_262384 | 3300042612 | Bacteria | 13428 |
| 89 | Ga0466734_141634 | 3300042623 | Bacteria | 54922 |
| 90 | Ga0466703_288938 | 3300042636 | Bacteria | 16390 |
| 91 | Ga0466704_130376 | 3300042643 | Bacteria | 60549 |
| 92 | Ga0466725_370409 | 3300042654 | Bacteria | 1312 |
| 93 | Ga0123356_10353887 | 3300010049 | Bacteria | 1593 |
| 94 | Ga0123356_10355176 | 3300010049 | Bacteria | 1591 |
| 95 | CVPL005W_1000081 | 3300002934 | Bacteria | 37014 |
| 96 | Ga0103264_1000520 | 3300007188 | Bacteria | 20031 |
| 97 | Ga0160467_100492 | 3300012829 | Bacteria | 38180 |
| 98 | Ga0466692_142749 | 3300042591 | Bacteria | 3759 |
| 99 | Ga0466713_117051 | 3300042602 | Bacteria | 14825 |
| 100 | Ga0466714_097452 | 3300042603 | Bacteria | 3109 |
| 101 | Ga0466717_248157 | 3300042604 | Unclassified | 1534 |
| 102 | Ga0466698_221064 | 3300042610 | Bacteria | 12363 |
| 103 | Ga0466715_114127 | 3300042616 | Bacteria | 3796 |
| 104 | Ga0466726_091773 | 3300042619 | Bacteria | 15612 |
| 105 | Ga0466726_287379 | 3300042619 | Bacteria | 3124 |
| 106 | Ga0466705_272892 | 3300042612 | Bacteria | 10606 |
| 107 | Ga0466734_030990 | 3300042623 | Bacteria | 1721 |
| 108 | Ga0160471_100007 | 3300012812 | Bacteria | 543831 |
| 109 | CVPL005W_1001957 | 3300002934 | Bacteria | 4597 |
| 110 | Ga0102734_1001334 | 3300007129 | Bacteria | 18976 |
| 111 | Ga0160446_100112 | 3300012835 | Bacteria | 73516 |
| 112 | Ga0160460_100177 | 3300012845 | Bacteria | 70489 |
| 113 | Ga0466691_203768 | 3300042593 | Bacteria | 6908 |
| 114 | Ga0466696_336295 | 3300042596 | Unclassified | 2118 |
| 115 | Ga0466696_346773 | 3300042596 | Bacteria | 16510 |
| 116 | Ga0466722_053869 | 3300042609 | Bacteria | 40279 |
| 117 | Ga0466710_034360 | 3300042613 | Bacteria | 1265 |
| 118 | Ga0466723_221067 | 3300042618 | Bacteria | 2567 |
| 119 | Ga0466726_035068 | 3300042619 | Bacteria | 1397 |
| 120 | Ga0466729_162357 | 3300042621 | Bacteria | 1539 |
| 121 | Ga0466734_097317 | 3300042623 | Bacteria | 1382 |
| 122 | Ga0466703_400865 | 3300042636 | Bacteria | 9966 |
| 123 | Ga0466727_259305 | 3300042655 | Bacteria | 1271 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00676 | E1_dh | Dehydrogenase E1 component | 52 | 349 | 0.98 |
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF00676 | GO:0016624 | oxidoreductase activity, acting on the aldehyde or oxo group of donors, disulfide as acceptor | MF |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.