Protein Family IF11337
Metagenome
Isolate
285
Members
90
Samples
248
Scaffolds
205.06
Avg Length
Representative Sequence
- ID
- iso_pr_bacteria|2695420317|2695484465|
- Length
- 246 aa
- Sequence
- MAIDDDIIFFIDMLIEQPPLVYRLLFPGGYWRLPSRNEKVIYLTFDDGPIPELTPWVLDLLDKYDIKATFFCVGDNVRKYPEIYQEVLDRGHSVGNHTFNHIQGIKSRTKSYMKNAELASEYIESPLFRPPHGHMRLPQFFKLRKKYKIILWDVVTRDYSNKQTPEEVLENVKHYGRNGSIVVFHDSIKAEKNMKYALPLAIEWFKEQGYVFKTIEEGLAETTNEVTETNLHNSESDTRELVRDYR
Sample Types
Isolate
13.0%
Metagenome
87.0%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Blattidae
30.3%
Termitidae
27.0%
Kalotermitidae
15.7%
Unclassified
10.1%
Rhinotermitidae
5.6%
Termopsidae
4.5%
Passalidae
2.2%
Hydrophilidae
2.2%
Hodotermitidae
1.1%
Tenebrionidae
1.1%
Taxonomy
Archaea
0
Bacteria
275
Eukaryota
0
Viruses
0
Unclassified
10
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 2 | 2695420931 | Dysgonomonas macrotermitis DSM 27370 | Isolate | Unclassified |
| 3 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 4 | 2940205530 | Parabacteroides sp. PH5-33 | Isolate | Blattidae |
| 5 | 2940216256 | Dysgonomonadaceae bacterium PH5-43 | Isolate | Blattidae |
| 6 | 2940317558 | Parabacteroides sp. PH5-26 | Isolate | Blattidae |
| 7 | 2940325180 | Parabacteroides sp. PH5-41 | Isolate | Blattidae |
| 8 | 2695420317 | Dysgonomonas sp. HGC4 | Isolate | Unclassified |
| 9 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 10 | 2940257232 | Dysgonomonas sp. PFB1-18 | Isolate | Blattidae |
| 11 | 2940313741 | Parabacteroides sp. PH5-17 | Isolate | Blattidae |
| 12 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 13 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 14 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 15 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 16 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 17 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 18 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 19 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 20 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 21 | 2873610414 | Dysgonomonas sp. HDW5B | Isolate | Hydrophilidae |
| 22 | 2940199050 | Parabacteroides sp. PM6-13 | Isolate | Blattidae |
| 23 | 2940371297 | Parabacteroides sp. PM5-20 | Isolate | Blattidae |
| 24 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 25 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 26 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 27 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 28 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 29 | 2820778767 | Unclassified Bacteroidetes Emb289P4bin10 | Isolate | Unclassified |
| 30 | 2830041218 | Bacteroides reticulotermitis DSM 105720 | Isolate | Unclassified |
| 31 | 2910930387 | Dysgonomonas sp. 216 | Isolate | Blattidae |
| 32 | 2910942425 | Dysgonomonas sp. 521 | Isolate | Blattidae |
| 33 | 2940212447 | Parabacteroides sp. PH5-16 | Isolate | Blattidae |
| 34 | 2940244548 | Dysgonomonas sp. PF1-14 | Isolate | Blattidae |
| 35 | 2940302308 | Parabacteroides sp. PF5-5 | Isolate | Blattidae |
| 36 | 2940321370 | Parabacteroides sp. PH5-39 | Isolate | Blattidae |
| 37 | 2940332795 | Parabacteroides sp. PH5-8 | Isolate | Blattidae |
| 38 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 39 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 40 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 41 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 42 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 43 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 44 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 45 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 46 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 47 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 48 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 49 | 8100157865 | Dysgonomonas sp. GY617 | Isolate | Rhinotermitidae |
| 50 | 2820759988 | Unclassified Bacteroidetes Mp193P4bin4 | Isolate | Unclassified |
| 51 | 2910949487 | Dysgonomonas sp. 520 | Isolate | Blattidae |
| 52 | 2923982719 | Parabacteroides sp. 52 | Isolate | Blattidae |
| 53 | 2940306115 | Parabacteroides sp. PFB2-22 | Isolate | Blattidae |
| 54 | 2940309933 | Parabacteroides sp. PH5-13 | Isolate | Blattidae |
| 55 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 56 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 57 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 58 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 59 | 2609459943 | Bacteroides reticulotermitis JCM 10512 | Isolate | Rhinotermitidae |
| 60 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 61 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 62 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 63 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 64 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 65 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 66 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 67 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 68 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 69 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 70 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 71 | 3004667792 | Bacteroides sp. 519 | Isolate | Blattidae |
| 72 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 73 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 74 | 2910926975 | Dysgonomonas sp. 25 | Isolate | Blattidae |
| 75 | 2940209341 | Parabacteroides sp. PFB2-10 | Isolate | Blattidae |
| 76 | 2940298504 | Parabacteroides sp. PF5-13 | Isolate | Blattidae |
| 77 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 78 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 79 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 80 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 81 | 3004677695 | Bacteroides sp. 214 | Isolate | Blattidae |
| 82 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 83 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 84 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 85 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
| 86 | 2820924633 | Unclassified Actinobacteria Emb289P3bin142 | Isolate | Unclassified |
| 87 | 2873600114 | Dysgonomonas sp. HDW5A | Isolate | Hydrophilidae |
| 88 | 2940193328 | Dysgonomonas sp. PH5-45 | Isolate | Blattidae |
| 89 | 2940248789 | Dysgonomonas sp. PF1-16 | Isolate | Blattidae |
| 90 | 2940346213 | Parabacteroides sp. PFB2-12 | Isolate | Blattidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466734_092301 | 3300042623 | Bacteria | 7839 |
| 2 | Ga0466703_167489 | 3300042636 | Bacteria | 9555 |
| 3 | Ga0466703_239577 | 3300042636 | Bacteria | 10186 |
| 4 | Ga0466703_264743 | 3300042636 | Bacteria | 19401 |
| 5 | Ga0466703_315636 | 3300042636 | Bacteria | 5224 |
| 6 | Ga0466704_571254 | 3300042643 | Bacteria | 3661 |
| 7 | Ga0466709_126797 | 3300042648 | Bacteria | 12218 |
| 8 | Ga0466708_129466 | 3300042652 | Bacteria | 13475 |
| 9 | Ga0466727_176346 | 3300042655 | Bacteria | 17609 |
| 10 | Ga0415639_004873 | 3300038395 | Bacteria | 3651 |
| 11 | Ga0466691_006015 | 3300042593 | Unclassified | 1638 |
| 12 | Ga0466715_101610 | 3300042616 | Bacteria | 54990 |
| 13 | Ga0466723_186224 | 3300042618 | Bacteria | 1388 |
| 14 | Ga0466729_066508 | 3300042621 | Bacteria | 6302 |
| 15 | Ga0466706_269774 | 3300042599 | Bacteria | 1904 |
| 16 | Ga0466707_270832 | 3300042601 | Bacteria | 16847 |
| 17 | Ga0466713_014420 | 3300042602 | Bacteria | 4824 |
| 18 | Ga0466713_015196 | 3300042602 | Bacteria | 51519 |
| 19 | Ga0466714_085214 | 3300042603 | Bacteria | 1128 |
| 20 | Ga0466716_427092 | 3300042605 | Bacteria | 15816 |
| 21 | Ga0466719_104192 | 3300042606 | Bacteria | 10818 |
| 22 | Ga0466722_058481 | 3300042609 | Bacteria | 6372 |
| 23 | Ga0466697_029518 | 3300042611 | Bacteria | 1250 |
| 24 | Ga0123356_10001294 | 3300010049 | Bacteria | 27732 |
| 25 | Ga0123356_11388112 | 3300010049 | Bacteria | 863 |
| 26 | Ga0123354_10326796 | 3300010882 | Bacteria | 1405 |
| 27 | JGI24705J35276_12226531 | 3300002504 | Bacteria | 2869 |
| 28 | JGI24696J40584_12960366 | 3300002834 | Bacteria | 7030 |
| 29 | Ga0068305_10026750 | 3300005083 | Bacteria | 10368 |
| 30 | Ga0123357_10000608 | 3300009784 | Bacteria | 35490 |
| 31 | Ga0466697_079217 | 3300042611 | Bacteria | 2126 |
| 32 | Ga0466733_131608 | 3300042659 | Bacteria | 1614 |
| 33 | Ga0466729_247545 | 3300042621 | Bacteria | 6761 |
| 34 | Ga0466735_054987 | 3300042624 | Bacteria | 4992 |
| 35 | Ga0466735_080545 | 3300042624 | Unclassified | 2305 |
| 36 | Ga0466704_184798 | 3300042643 | Bacteria | 12085 |
| 37 | Ga0466725_138136 | 3300042654 | Bacteria | 17555 |
| 38 | Ga0466727_232021 | 3300042655 | Bacteria | 6418 |
| 39 | Ga0466657_237558 | 3300042582 | Bacteria | 26291 |
| 40 | Ga0466692_199532 | 3300042591 | Bacteria | 2010 |
| 41 | Ga0466693_212493 | 3300042592 | Bacteria | 1809 |
| 42 | Ga0466696_120458 | 3300042596 | Bacteria | 7889 |
| 43 | Ga0466710_063410 | 3300042613 | Bacteria | 3084 |
| 44 | Ga0466715_337503 | 3300042616 | Bacteria | 17152 |
| 45 | Ga0466715_461898 | 3300042616 | Bacteria | 12878 |
| 46 | Ga0466726_250742 | 3300042619 | Bacteria | 2414 |
| 47 | Ga0466701_076713 | 3300042598 | Bacteria | 1288 |
| 48 | Ga0466713_023969 | 3300042602 | Bacteria | 6643 |
| 49 | Ga0466713_080056 | 3300042602 | Bacteria | 11334 |
| 50 | Ga0466714_133301 | 3300042603 | Bacteria | 9650 |
| 51 | Ga0466719_013919 | 3300042606 | Bacteria | 2068 |
| 52 | Ga0466722_037843 | 3300042609 | Bacteria | 5625 |
| 53 | Ga0123357_10039091 | 3300009784 | Unclassified | 6461 |
| 54 | Ga0123357_10256029 | 3300009784 | Bacteria | 1861 |
| 55 | Ga0123353_10591081 | 3300010167 | Bacteria | 1590 |
| 56 | Ga0123354_10554856 | 3300010882 | Bacteria | 864 |
| 57 | IMNBL1DRAFT_c0000047 | 3300000062 | Bacteria | 113822 |
| 58 | JGI24698J34947_10051141 | 3300002449 | Bacteria | 2080 |
| 59 | JGI24699J35502_11134222 | 3300002509 | Bacteria | 70815 |
| 60 | JGI24696J40584_12960119 | 3300002834 | Bacteria | 6377 |
| 61 | Ga0068305_10097790 | 3300005083 | Bacteria | 5156 |
| 62 | Ga0466705_213506 | 3300042612 | Bacteria | 8196 |
| 63 | Ga0466733_070989 | 3300042659 | Bacteria | 25252 |
| 64 | Ga0466733_172753 | 3300042659 | Bacteria | 2803 |
| 65 | Ga0466735_071698 | 3300042624 | Bacteria | 4273 |
| 66 | Ga0466735_090243 | 3300042624 | Bacteria | 2450 |
| 67 | Ga0466703_002530 | 3300042636 | Bacteria | 34046 |
| 68 | Ga0466703_423871 | 3300042636 | Bacteria | 1978 |
| 69 | Ga0466709_026512 | 3300042648 | Bacteria | 33059 |
| 70 | Ga0466709_389091 | 3300042648 | Bacteria | 9829 |
| 71 | Ga0466690_034613 | 3300042590 | Bacteria | 14840 |
| 72 | Ga0466693_422664 | 3300042592 | Bacteria | 1325 |
| 73 | Ga0466691_157484 | 3300042593 | Bacteria | 6445 |
| 74 | Ga0466696_141945 | 3300042596 | Bacteria | 13688 |
| 75 | Ga0466705_420220 | 3300042612 | Bacteria | 3015 |
| 76 | Ga0466715_046669 | 3300042616 | Bacteria | 6502 |
| 77 | Ga0466715_078929 | 3300042616 | Bacteria | 42957 |
| 78 | Ga0466726_060177 | 3300042619 | Bacteria | 18658 |
| 79 | Ga0466726_266284 | 3300042619 | Bacteria | 7628 |
| 80 | Ga0466700_045565 | 3300042600 | Bacteria | 11162 |
| 81 | Ga0466707_025652 | 3300042601 | Bacteria | 6234 |
| 82 | Ga0466707_071203 | 3300042601 | Bacteria | 38562 |
| 83 | Ga0466713_143627 | 3300042602 | Bacteria | 22529 |
| 84 | Ga0466722_156698 | 3300042609 | Bacteria | 5471 |
| 85 | Ga0123356_10898107 | 3300010049 | Bacteria | 1057 |
| 86 | Ga0123354_10000040 | 3300010882 | Bacteria | 96699 |
| 87 | Ga0123354_10010176 | 3300010882 | Bacteria | 14469 |
| 88 | Ga0123354_10020086 | 3300010882 | Bacteria | 10502 |
| 89 | JGI24702J35022_10002069 | 3300002462 | Bacteria | 12374 |
| 90 | Ga0068305_10012279 | 3300005083 | Bacteria | 7378 |
| 91 | Ga0466733_148277 | 3300042659 | Bacteria | 18385 |
| 92 | Ga0466733_219753 | 3300042659 | Bacteria | 9709 |
| 93 | Ga0562377_0004 | 3300056842 | Bacteria | 3525959 |
| 94 | Ga0466731_390333 | 3300042622 | Bacteria | 1413 |
| 95 | Ga0466735_052770 | 3300042624 | Bacteria | 1454 |
| 96 | Ga0466735_195999 | 3300042624 | Bacteria | 2469 |
| 97 | Ga0466703_429392 | 3300042636 | Bacteria | 14477 |
| 98 | Ga0466704_048096 | 3300042643 | Bacteria | 16829 |
| 99 | Ga0466708_460639 | 3300042652 | Bacteria | 18491 |
| 100 | Ga0466727_011770 | 3300042655 | Bacteria | 7557 |
| 101 | Ga0466727_315271 | 3300042655 | Bacteria | 4546 |
| 102 | Ga0466694_381962 | 3300042594 | Bacteria | 1047 |
| 103 | Ga0466715_138198 | 3300042616 | Bacteria | 11347 |
| 104 | Ga0466715_253859 | 3300042616 | Bacteria | 4287 |
| 105 | Ga0466715_433782 | 3300042616 | Bacteria | 21980 |
| 106 | Ga0466723_148662 | 3300042618 | Bacteria | 50232 |
| 107 | Ga0466728_236788 | 3300042620 | Bacteria | 1580 |
| 108 | Ga0466706_034377 | 3300042599 | Bacteria | 1011 |
| 109 | Ga0466706_140791 | 3300042599 | Bacteria | 1712 |
| 110 | Ga0466706_259237 | 3300042599 | Bacteria | 35111 |
| 111 | Ga0466700_156640 | 3300042600 | Bacteria | 23709 |
| 112 | Ga0466700_413326 | 3300042600 | Unclassified | 2507 |
| 113 | Ga0466713_032406 | 3300042602 | Bacteria | 15683 |
| 114 | Ga0123357_10038183 | 3300009784 | Unclassified | 6538 |
| 115 | Ga0123356_10000115 | 3300010049 | Bacteria | 86679 |
| 116 | Ga0123356_10223143 | 3300010049 | Bacteria | 1942 |
| 117 | Ga0123353_10000923 | 3300010167 | Bacteria | 35866 |
| 118 | Ga0123353_10452720 | 3300010167 | Bacteria | 1889 |
| 119 | Ga0123354_10056229 | 3300010882 | Unclassified | 5877 |
| 120 | Ga0123354_10277271 | 3300010882 | Bacteria | 1636 |
| 121 | 2227222500 | 2225789004 | Bacteria | 1385 |
| 122 | JGI24702J35022_10000119 | 3300002462 | Bacteria | 37881 |
| 123 | Ga0068302_10052299 | 3300005071 | Bacteria | 3183 |
| 124 | Ga0068302_10505657 | 3300005071 | Bacteria | 2542 |
| 125 | Ga0068305_10828244 | 3300005083 | Bacteria | 800 |
| 126 | Ga0466705_084401 | 3300042612 | Bacteria | 19488 |
| 127 | Ga0466703_272507 | 3300042636 | Bacteria | 3946 |
| 128 | Ga0466704_044022 | 3300042643 | Bacteria | 23517 |
| 129 | Ga0466727_184423 | 3300042655 | Bacteria | 96228 |
| 130 | Ga0466727_213846 | 3300042655 | Bacteria | 1615 |
| 131 | Ga0466727_267339 | 3300042655 | Bacteria | 1046 |
| 132 | Ga0466690_063983 | 3300042590 | Bacteria | 7446 |
| 133 | Ga0466690_427573 | 3300042590 | Bacteria | 11112 |
| 134 | Ga0466692_122805 | 3300042591 | Bacteria | 1000 |
| 135 | Ga0466694_132686 | 3300042594 | Bacteria | 1527 |
| 136 | Ga0466695_335820 | 3300042595 | Bacteria | 5112 |
| 137 | Ga0466696_140042 | 3300042596 | Bacteria | 14846 |
| 138 | Ga0466710_139486 | 3300042613 | Bacteria | 4548 |
| 139 | Ga0466723_167601 | 3300042618 | Bacteria | 5925 |
| 140 | Ga0466723_288619 | 3300042618 | Bacteria | 4994 |
| 141 | Ga0466726_443165 | 3300042619 | Bacteria | 5657 |
| 142 | Ga0466706_140857 | 3300042599 | Bacteria | 123527 |
| 143 | Ga0466700_207576 | 3300042600 | Bacteria | 5351 |
| 144 | Ga0466707_237149 | 3300042601 | Bacteria | 2821 |
| 145 | Ga0466707_270689 | 3300042601 | Bacteria | 5663 |
| 146 | Ga0466707_329828 | 3300042601 | Bacteria | 29839 |
| 147 | Ga0466714_118026 | 3300042603 | Bacteria | 60394 |
| 148 | Ga0466716_394397 | 3300042605 | Bacteria | 13058 |
| 149 | Ga0466716_425371 | 3300042605 | Bacteria | 22742 |
| 150 | Ga0466719_382724 | 3300042606 | Bacteria | 5906 |
| 151 | Ga0466698_506225 | 3300042610 | Bacteria | 1497 |
| 152 | Ga0123353_10901862 | 3300010167 | Bacteria | 1203 |
| 153 | 2227194702 | 2225789004 | Bacteria | 7846 |
| 154 | IMNBL1DRAFT_c0001529 | 3300000062 | Bacteria | 17233 |
| 155 | JGI24699J35502_11134171 | 3300002509 | Bacteria | 43800 |
| 156 | Ga0068305_10060045 | 3300005083 | Bacteria | 12737 |
| 157 | Ga0072941_1317552 | 3300005201 | Bacteria | 2739 |
| 158 | Ga0466697_066144 | 3300042611 | Bacteria | 115209 |
| 159 | Ga0466705_384814 | 3300042612 | Bacteria | 5011 |
| 160 | Ga0466703_207937 | 3300042636 | Bacteria | 2866 |
| 161 | Ga0466709_358740 | 3300042648 | Bacteria | 10195 |
| 162 | Ga0466725_177398 | 3300042654 | Bacteria | 9321 |
| 163 | Ga0466693_030515 | 3300042592 | Unclassified | 2534 |
| 164 | Ga0466723_300794 | 3300042618 | Bacteria | 4961 |
| 165 | Ga0466726_138423 | 3300042619 | Bacteria | 12622 |
| 166 | Ga0466707_096701 | 3300042601 | Bacteria | 20658 |
| 167 | Ga0466707_183664 | 3300042601 | Bacteria | 9147 |
| 168 | Ga0466713_058794 | 3300042602 | Bacteria | 46658 |
| 169 | Ga0466713_127738 | 3300042602 | Bacteria | 8131 |
| 170 | Ga0466714_110964 | 3300042603 | Bacteria | 4183 |
| 171 | Ga0466716_224517 | 3300042605 | Bacteria | 2785 |
| 172 | Ga0466716_544357 | 3300042605 | Bacteria | 11027 |
| 173 | Ga0466719_057413 | 3300042606 | Bacteria | 8151 |
| 174 | Ga0466719_503768 | 3300042606 | Bacteria | 16604 |
| 175 | Ga0466719_532118 | 3300042606 | Bacteria | 1623 |
| 176 | Ga0123356_10038641 | 3300010049 | Bacteria | 4448 |
| 177 | Ga0123353_10471358 | 3300010167 | Bacteria | 1841 |
| 178 | Ga0123354_10130802 | 3300010882 | Bacteria | 3171 |
| 179 | Ga0123354_10472182 | 3300010882 | Bacteria | 999 |
| 180 | 2227357719 | 2225789004 | Bacteria | 1132 |
| 181 | 2227536314 | 2225789004 | Bacteria | 3066 |
| 182 | JGI24705J35276_12238770 | 3300002504 | Bacteria | 57808 |
| 183 | Ga0068305_10106510 | 3300005083 | Bacteria | 1136 |
| 184 | Ga0466705_033023 | 3300042612 | Bacteria | 10482 |
| 185 | Ga0466733_046877 | 3300042659 | Bacteria | 7462 |
| 186 | Ga0466733_123445 | 3300042659 | Bacteria | 34288 |
| 187 | Ga0466735_092039 | 3300042624 | Bacteria | 3494 |
| 188 | Ga0466703_065818 | 3300042636 | Bacteria | 14556 |
| 189 | Ga0466704_098763 | 3300042643 | Bacteria | 16759 |
| 190 | Ga0466704_335445 | 3300042643 | Bacteria | 1261 |
| 191 | Ga0466709_005110 | 3300042648 | Bacteria | 10192 |
| 192 | Ga0466727_322923 | 3300042655 | Bacteria | 4838 |
| 193 | Ga0466690_327588 | 3300042590 | Bacteria | 16605 |
| 194 | Ga0466696_292712 | 3300042596 | Bacteria | 4490 |
| 195 | Ga0466710_014976 | 3300042613 | Bacteria | 1977 |
| 196 | Ga0466710_232200 | 3300042613 | Unclassified | 1295 |
| 197 | Ga0466711_019617 | 3300042615 | Bacteria | 9281 |
| 198 | Ga0466715_320520 | 3300042616 | Bacteria | 19970 |
| 199 | Ga0466715_321784 | 3300042616 | Bacteria | 32345 |
| 200 | Ga0466715_464975 | 3300042616 | Bacteria | 101862 |
| 201 | Ga0466723_000145 | 3300042618 | Bacteria | 1808 |
| 202 | Ga0466723_035858 | 3300042618 | Bacteria | 52046 |
| 203 | Ga0466706_223858 | 3300042599 | Bacteria | 16411 |
| 204 | Ga0466707_056939 | 3300042601 | Bacteria | 7871 |
| 205 | Ga0466707_394670 | 3300042601 | Bacteria | 1248 |
| 206 | Ga0466707_423135 | 3300042601 | Bacteria | 15793 |
| 207 | Ga0466713_004179 | 3300042602 | Bacteria | 14388 |
| 208 | Ga0466716_055378 | 3300042605 | Bacteria | 11135 |
| 209 | Ga0466722_167510 | 3300042609 | Bacteria | 1362 |
| 210 | Ga0466722_193438 | 3300042609 | Bacteria | 4901 |
| 211 | Ga0123357_10034714 | 3300009784 | Bacteria | 6857 |
| 212 | Ga0123357_10038486 | 3300009784 | Bacteria | 6512 |
| 213 | Ga0123354_10059757 | 3300010882 | Bacteria | 5650 |
| 214 | Ga0123354_10085425 | 3300010882 | Bacteria | 4420 |
| 215 | 2227197489 | 2225789004 | Bacteria | 7791 |
| 216 | 2227506854 | 2225789004 | Unclassified | 3651 |
| 217 | IMNBL1DRAFT_c0025003 | 3300000062 | Bacteria | 2299 |
| 218 | JGI24702J35022_10002109 | 3300002462 | Bacteria | 12277 |
| 219 | JGI24696J40584_12946569 | 3300002834 | Bacteria | 1905 |
| 220 | Ga0068302_10025514 | 3300005071 | Unclassified | 844 |
| 221 | Ga0072941_1074123 | 3300005201 | Bacteria | 5008 |
| 222 | Ga0123357_10003328 | 3300009784 | Bacteria | 18381 |
| 223 | Ga0466697_162325 | 3300042611 | Bacteria | 2476 |
| 224 | Ga0466735_067082 | 3300042624 | Bacteria | 1613 |
| 225 | Ga0466735_090852 | 3300042624 | Bacteria | 7986 |
| 226 | Ga0466735_140123 | 3300042624 | Bacteria | 1810 |
| 227 | Ga0466735_178588 | 3300042624 | Bacteria | 1296 |
| 228 | Ga0466703_309315 | 3300042636 | Bacteria | 14627 |
| 229 | Ga0466709_100118 | 3300042648 | Bacteria | 6050 |
| 230 | Ga0466657_010574 | 3300042582 | Bacteria | 1642 |
| 231 | Ga0466690_280569 | 3300042590 | Bacteria | 14689 |
| 232 | Ga0466696_108634 | 3300042596 | Bacteria | 2345 |
| 233 | Ga0466696_440736 | 3300042596 | Bacteria | 1472 |
| 234 | Ga0466711_131421 | 3300042615 | Bacteria | 29142 |
| 235 | Ga0466711_335431 | 3300042615 | Bacteria | 6998 |
| 236 | Ga0466711_478351 | 3300042615 | Bacteria | 4770 |
| 237 | Ga0466706_102073 | 3300042599 | Bacteria | 35308 |
| 238 | Ga0466707_053511 | 3300042601 | Bacteria | 4976 |
| 239 | Ga0466713_061789 | 3300042602 | Bacteria | 88378 |
| 240 | Ga0466713_103208 | 3300042602 | Bacteria | 3516 |
| 241 | Ga0466714_053611 | 3300042603 | Bacteria | 12525 |
| 242 | Ga0123357_10004022 | 3300009784 | Bacteria | 17106 |
| 243 | Ga0123357_10116165 | 3300009784 | Bacteria | 3389 |
| 244 | Ga0123356_10007042 | 3300010049 | Bacteria | 11273 |
| 245 | JGI24702J35022_10040439 | 3300002462 | Bacteria | 2486 |
| 246 | JGI24705J35276_12187258 | 3300002504 | Bacteria | 1428 |
| 247 | Ga0068302_10390607 | 3300005071 | Bacteria | 724 |
| 248 | Ga0072941_1566753 | 3300005201 | Bacteria | 2324 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF01522 | Polysacc_deac_1 | Polysaccharide deacetylase | 36 | 134 | 0.89 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.