Protein Family IF11333
Metagenome
Isolate
183
Members
117
Samples
124
Scaffolds
574.26
Avg Length
Representative Sequence
- ID
- iso_pr_bacteria|2695420314|2695473391|
- Length
- 636 aa
- Sequence
- LRLLIGRLSYVEYSLGWEQANGLFTTNRYLKFLMKTFEELGVAANIRKAIEEMGYENPMPVQEEVIPYLLDEIRDVIALAQTGTGKTAAFGLPVLQKIEVKENAPQALILCPTRELCLQIAGDLADYSKYIDNLRVLPVYGGSSIDSQIRSLKRGVHIIVATPGRLIDLINRKTVDLAKVKYVVLDEADEMLNMGFTESIDEILAKVPSDRSMLLFSATMPKEISKITKKYMESPKEITVGRKNEGTSTVKHVYYMVHAKDKYLALKRIADFYPNIYGIIFCRTRRETQEIADKLIQDGYNADSLHGDLSQAQRDYVMQKFRIKNIQLLVATDVAARGLDVDSLTHVINYGLPDDTESYTHRSGRTGRAGKTGTSIAIVHVKEKGKIRELEKILNKKFEQGVIPSGEEICEKQLFSLVDRIEKVKVNEDEISNLLPSVYRKLEWLEKEDIIKRVMALEFNRLIDYYRDAQEIESPSDRYVKGEDKLYPRRKDRERGDRASGGRGAEKGYSRLFINIGRTDNVNPATLMGLVNDFVPEKVNIGRIDIMQNFSFFEVPERDAQKVIKSMSRQEQNGRRISVEVAQGGGGGDRSGDRNRGGFSPRSDKDRGFKRDSDFKSSKPKSSDKGGHRKGRKPKY
Sample Types
Isolate
32.2%
Metagenome
67.8%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Blattidae
27.5%
Formicidae
14.7%
Termitidae
11.9%
Kalotermitidae
11.9%
Unclassified
7.3%
Armadillidiidae
5.5%
Drosophilidae
3.7%
Culicidae
2.8%
Rhinotermitidae
2.8%
Passalidae
2.8%
Hydrophilidae
2.8%
Termopsidae
2.8%
Daphniidae
0.9%
Bombycidae
0.9%
Tenebrionidae
0.9%
Hodotermitidae
0.9%
Taxonomy
Archaea
0
Bacteria
174
Eukaryota
0
Viruses
0
Unclassified
9
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2547132042 | Pseudonocardia sp. P2 | Isolate | Formicidae |
| 2 | 2695420317 | Dysgonomonas sp. HGC4 | Isolate | Unclassified |
| 3 | 2718217924 | Pseudonocardia sp. HH130630-07 | Isolate | Formicidae |
| 4 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 5 | 3300007085 | Drosophila gut microbial communities from New York, USA - Drosophila neotestacea male 3 gut | Metagenome | Drosophilidae |
| 6 | 3300012824 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E11 MG | Metagenome | Armadillidiidae |
| 7 | 3300012835 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E1 MG | Metagenome | Culicidae |
| 8 | 3300012837 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E6 MG | Metagenome | Armadillidiidae |
| 9 | 3300012849 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG | Metagenome | Culicidae |
| 10 | 2856960404 | Pseudonocardia sp. Ae706_Ps2 | Isolate | Formicidae |
| 11 | 2856973192 | Pseudonocardia sp. Ae331_Ps2 | Isolate | Formicidae |
| 12 | 2859970369 | Pseudonocardia sp. Ae717_Ps2 | Isolate | Formicidae |
| 13 | 2896321640 | Sphingobacterium sp. xlx-130 | Isolate | |
| 14 | 2940253009 | Dysgonomonas sp. PF1-23 | Isolate | Blattidae |
| 15 | 2940257232 | Dysgonomonas sp. PFB1-18 | Isolate | Blattidae |
| 16 | 2940313741 | Parabacteroides sp. PH5-17 | Isolate | Blattidae |
| 17 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 18 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 19 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 20 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 21 | 2695420931 | Dysgonomonas macrotermitis DSM 27370 | Isolate | Unclassified |
| 22 | 3300007140 | Ant gut microbial communities from Cephalotes pallens, Brazil | Metagenome | Formicidae |
| 23 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 24 | 3300012858 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG | Metagenome | Armadillidiidae |
| 25 | 2856954254 | Pseudonocardia sp. Ae505_Ps2 | Isolate | Formicidae |
| 26 | 2896330536 | Sphingobacterium sp. xlx-96 | Isolate | |
| 27 | 2940205530 | Parabacteroides sp. PH5-33 | Isolate | Blattidae |
| 28 | 2940216256 | Dysgonomonadaceae bacterium PH5-43 | Isolate | Blattidae |
| 29 | 2940317558 | Parabacteroides sp. PH5-26 | Isolate | Blattidae |
| 30 | 2940325180 | Parabacteroides sp. PH5-41 | Isolate | Blattidae |
| 31 | 2225789003 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) | Metagenome | Passalidae |
| 32 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 33 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 34 | 3300012841 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E1 MG | Metagenome | Armadillidiidae |
| 35 | 2820778767 | Unclassified Bacteroidetes Emb289P4bin10 | Isolate | Unclassified |
| 36 | 2820789850 | Unclassified Bacteroidetes Cu122P3bin3 | Isolate | Unclassified |
| 37 | 2856671350 | Pseudonocardia sp. Ae356_Ps1 | Isolate | Formicidae |
| 38 | 2856947901 | Pseudonocardia sp. Ae168_Ps1 | Isolate | Formicidae |
| 39 | 2910930387 | Dysgonomonas sp. 216 | Isolate | Blattidae |
| 40 | 2910942425 | Dysgonomonas sp. 521 | Isolate | Blattidae |
| 41 | 2940212447 | Parabacteroides sp. PH5-16 | Isolate | Blattidae |
| 42 | 2940244548 | Dysgonomonas sp. PF1-14 | Isolate | Blattidae |
| 43 | 2940302308 | Parabacteroides sp. PF5-5 | Isolate | Blattidae |
| 44 | 2940321370 | Parabacteroides sp. PH5-39 | Isolate | Blattidae |
| 45 | 2940332795 | Parabacteroides sp. PH5-8 | Isolate | Blattidae |
| 46 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 47 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 48 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 49 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 50 | 2590828803 | Pedobacter glucosidilyticus DD6b | Isolate | Daphniidae |
| 51 | 2671180625 | Pseudonocardia sp. EC080619-01 | Isolate | Formicidae |
| 52 | 2695420314 | Dysgonomonas sp. BGC7 | Isolate | Unclassified |
| 53 | 3300012846 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG | Metagenome | Armadillidiidae |
| 54 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 55 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 56 | 2873776654 | Pedobacter sp. HDW13 | Isolate | Hydrophilidae |
| 57 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 58 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 59 | 3300007150 | Drosophila gut microbial communities from New York, USA - Drosophila falleni female 3 gut | Metagenome | Drosophilidae |
| 60 | 3300012798 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E6 MG | Metagenome | |
| 61 | 3300012805 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E11 MG | Metagenome | |
| 62 | 3300012814 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E6 MG | Metagenome | |
| 63 | 3300007058 | Drosophila gut microbial communities from New York, USA - Drosophila neotestacea female 3 gut | Metagenome | Drosophilidae |
| 64 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 65 | 2896350215 | Sphingobacterium sp. xlx-183 | Isolate | |
| 66 | 2910926975 | Dysgonomonas sp. 25 | Isolate | Blattidae |
| 67 | 2940195863 | Parabacteroides sp. PF5-6 | Isolate | Blattidae |
| 68 | 2940209341 | Parabacteroides sp. PFB2-10 | Isolate | Blattidae |
| 69 | 2940298504 | Parabacteroides sp. PF5-13 | Isolate | Blattidae |
| 70 | 2940336608 | Dysgonomonas sp. PH5-37 | Isolate | Blattidae |
| 71 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 72 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 73 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 74 | 2579779088 | Sphingobacterium paucimobilis HER1398 | Isolate | Bombycidae |
| 75 | 3300012825 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E1 MG | Metagenome | |
| 76 | 3300012845 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E6 MG | Metagenome | Culicidae |
| 77 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 78 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 79 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
| 80 | 2873600114 | Dysgonomonas sp. HDW5A | Isolate | Hydrophilidae |
| 81 | 2940193328 | Dysgonomonas sp. PH5-45 | Isolate | Blattidae |
| 82 | 2940248789 | Dysgonomonas sp. PF1-16 | Isolate | Blattidae |
| 83 | 2940346213 | Parabacteroides sp. PFB2-12 | Isolate | Blattidae |
| 84 | 2675903497 | Pseudonocardia sp. EC080610-09 | Isolate | Formicidae |
| 85 | 2820757377 | Unclassified Bacteroidetes Mp193P4bin6 | Isolate | Unclassified |
| 86 | 3300007042 | Ant gut microbial communities from Cephalotes pusillus, Brazil | Metagenome | Formicidae |
| 87 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 88 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 89 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 90 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 91 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 92 | 2856966858 | Pseudonocardia sp. Ae263_Ps1 | Isolate | Formicidae |
| 93 | 2873610414 | Dysgonomonas sp. HDW5B | Isolate | Hydrophilidae |
| 94 | 2898741527 | Sphingobacterium sp. xlx-73 | Isolate | |
| 95 | 2940199050 | Parabacteroides sp. PM6-13 | Isolate | Blattidae |
| 96 | 2940202316 | Parabacteroides sp. PF5-9 | Isolate | Blattidae |
| 97 | 2940371297 | Parabacteroides sp. PM5-20 | Isolate | Blattidae |
| 98 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 99 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 100 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 101 | 3300002931 | Ant worker gut metagenome for colony PL010 | Metagenome | Formicidae |
| 102 | 3300007153 | Drosophila gut microbial communities from New York, USA - Drosophila putrida male 3 gut | Metagenome | Drosophilidae |
| 103 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 104 | 3300012829 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG | Metagenome | Armadillidiidae |
| 105 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 106 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 107 | 8100157865 | Dysgonomonas sp. GY617 | Isolate | Rhinotermitidae |
| 108 | 2856882415 | Pseudonocardia sp. Ae406_Ps2 | Isolate | Formicidae |
| 109 | 2859977607 | Pseudonocardia sp. Ae707_Ps1 | Isolate | Formicidae |
| 110 | 2910949487 | Dysgonomonas sp. 520 | Isolate | Blattidae |
| 111 | 2923982719 | Parabacteroides sp. 52 | Isolate | Blattidae |
| 112 | 2940306115 | Parabacteroides sp. PFB2-22 | Isolate | Blattidae |
| 113 | 2940309933 | Parabacteroides sp. PH5-13 | Isolate | Blattidae |
| 114 | 2940328985 | Parabacteroides sp. PH5-46 | Isolate | Blattidae |
| 115 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 116 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 117 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466713_033165 | 3300042602 | Bacteria | 31265 |
| 2 | Ga0466713_051288 | 3300042602 | Bacteria | 230715 |
| 3 | Ga0466722_064321 | 3300042609 | Bacteria | 2938 |
| 4 | Ga0466709_199317 | 3300042648 | Bacteria | 89856 |
| 5 | Ga0123354_10000042 | 3300010882 | Bacteria | 95103 |
| 6 | Ga0160454_100027 | 3300012798 | Bacteria | 281188 |
| 7 | Ga0466715_585896 | 3300042616 | Bacteria | 43231 |
| 8 | Ga0160444_100027 | 3300012841 | Bacteria | 254675 |
| 9 | Ga0466696_274892 | 3300042596 | Bacteria | 11757 |
| 10 | 2227191919 | 2225789004 | Bacteria | 7928 |
| 11 | IMNBL1DRAFT_c0003452 | 3300000062 | Bacteria | 10153 |
| 12 | JGI24699J35502_11133915 | 3300002509 | Bacteria | 19166 |
| 13 | JGI24699J35502_11134230 | 3300002509 | Bacteria | 99108 |
| 14 | Ga0103263_101185 | 3300007042 | Bacteria | 3436 |
| 15 | Ga0104043_1091427 | 3300007058 | Unclassified | 2532 |
| 16 | Ga0466705_122264 | 3300042612 | Bacteria | 3853 |
| 17 | Ga0466705_196728 | 3300042612 | Unclassified | 6766 |
| 18 | Ga0466732_423572 | 3300042656 | Bacteria | 33039 |
| 19 | Ga0466701_032214 | 3300042598 | Bacteria | 43207 |
| 20 | Ga0466714_052122 | 3300042603 | Bacteria | 2976 |
| 21 | Ga0466729_256562 | 3300042621 | Bacteria | 13219 |
| 22 | Ga0466703_128046 | 3300042636 | Bacteria | 8792 |
| 23 | Ga0123354_10063667 | 3300010882 | Bacteria | 5417 |
| 24 | Ga0466711_208849 | 3300042615 | Bacteria | 1981 |
| 25 | Ga0466715_273298 | 3300042616 | Unclassified | 8812 |
| 26 | Ga0466726_189450 | 3300042619 | Bacteria | 7503 |
| 27 | Ga0466728_057871 | 3300042620 | Bacteria | 2761 |
| 28 | Ga0466728_180564 | 3300042620 | Bacteria | 92308 |
| 29 | Ga0160469_100032 | 3300012824 | Bacteria | 268332 |
| 30 | JGI24699J35502_11133777 | 3300002509 | Bacteria | 15436 |
| 31 | Ga0072940_1092618 | 3300005200 | Bacteria | 8007 |
| 32 | Ga0123357_10000101 | 3300009784 | Bacteria | 70940 |
| 33 | Ga0466705_249448 | 3300042612 | Bacteria | 12035 |
| 34 | Ga0466705_373818 | 3300042612 | Bacteria | 18025 |
| 35 | Ga0562377_0004 | 3300056842 | Bacteria | 3525959 |
| 36 | Ga0466707_279376 | 3300042601 | Bacteria | 2477 |
| 37 | Ga0466707_295566 | 3300042601 | Bacteria | 11870 |
| 38 | Ga0466713_130991 | 3300042602 | Bacteria | 214088 |
| 39 | Ga0466719_025881 | 3300042606 | Bacteria | 6653 |
| 40 | Ga0466729_243682 | 3300042621 | Bacteria | 2855 |
| 41 | Ga0466734_094096 | 3300042623 | Bacteria | 4478 |
| 42 | Ga0160464_100046 | 3300012805 | Bacteria | 144789 |
| 43 | Ga0466711_246585 | 3300042615 | Bacteria | 12923 |
| 44 | Ga0466711_328156 | 3300042615 | Bacteria | 9449 |
| 45 | Ga0466711_434150 | 3300042615 | Bacteria | 10114 |
| 46 | Ga0466723_110176 | 3300042618 | Bacteria | 32755 |
| 47 | Ga0160457_1000556 | 3300012858 | Unclassified | 15511 |
| 48 | Ga0160457_1001065 | 3300012858 | Bacteria | 8669 |
| 49 | Ga0466690_217677 | 3300042590 | Bacteria | 30896 |
| 50 | Ga0466696_005035 | 3300042596 | Bacteria | 32427 |
| 51 | Ga0466696_285109 | 3300042596 | Bacteria | 2371 |
| 52 | IMNBL1DRAFT_c0001798 | 3300000062 | Bacteria | 15663 |
| 53 | Ga0104045_1003421 | 3300007085 | Unclassified | 35507 |
| 54 | Ga0466705_212115 | 3300042612 | Bacteria | 6321 |
| 55 | Ga0466713_064639 | 3300042602 | Bacteria | 150612 |
| 56 | Ga0466735_020872 | 3300042624 | Bacteria | 9028 |
| 57 | Ga0466735_053167 | 3300042624 | Bacteria | 12883 |
| 58 | Ga0466711_067911 | 3300042615 | Bacteria | 10482 |
| 59 | Ga0466715_077989 | 3300042616 | Unclassified | 24406 |
| 60 | Ga0466723_259632 | 3300042618 | Bacteria | 2835 |
| 61 | Ga0466726_042122 | 3300042619 | Bacteria | 5400 |
| 62 | Ga0466728_181334 | 3300042620 | Bacteria | 75129 |
| 63 | Ga0466728_301731 | 3300042620 | Bacteria | 5957 |
| 64 | Ga0160453_100449 | 3300012814 | Bacteria | 32281 |
| 65 | IMNBL1DRAFT_c0000949 | 3300000062 | Bacteria | 22355 |
| 66 | Ga0104045_1004571 | 3300007085 | Unclassified | 2796 |
| 67 | Ga0102740_1000062 | 3300007140 | Bacteria | 26226 |
| 68 | Ga0104050_1003982 | 3300007153 | Bacteria | 7095 |
| 69 | Ga0466733_054986 | 3300042659 | Bacteria | 147644 |
| 70 | Ga0466733_117643 | 3300042659 | Bacteria | 37134 |
| 71 | Ga0466706_141316 | 3300042599 | Bacteria | 25174 |
| 72 | Ga0466706_233023 | 3300042599 | Bacteria | 21200 |
| 73 | Ga0466700_067116 | 3300042600 | Bacteria | 9010 |
| 74 | Ga0466716_028430 | 3300042605 | Bacteria | 9140 |
| 75 | Ga0466716_207914 | 3300042605 | Bacteria | 10024 |
| 76 | Ga0466719_281655 | 3300042606 | Bacteria | 11106 |
| 77 | Ga0466730_054762 | 3300042625 | Bacteria | 344481 |
| 78 | Ga0466704_309403 | 3300042643 | Bacteria | 34772 |
| 79 | Ga0466704_479765 | 3300042643 | Bacteria | 17636 |
| 80 | Ga0466727_220111 | 3300042655 | Bacteria | 43243 |
| 81 | Ga0466726_003419 | 3300042619 | Bacteria | 66294 |
| 82 | Ga0466728_159995 | 3300042620 | Bacteria | 20105 |
| 83 | Ga0466728_272533 | 3300042620 | Bacteria | 27391 |
| 84 | Ga0160467_100154 | 3300012829 | Bacteria | 95468 |
| 85 | IMNBL1DRAFT_c0000360 | 3300000062 | Bacteria | 38595 |
| 86 | IMNBL1DRAFT_c0006385 | 3300000062 | Bacteria | 6450 |
| 87 | CVPL010W_10001408 | 3300002931 | Bacteria | 28235 |
| 88 | Ga0466733_047681 | 3300042659 | Unclassified | 6962 |
| 89 | Ga0466706_267060 | 3300042599 | Bacteria | 5078 |
| 90 | Ga0466707_395837 | 3300042601 | Bacteria | 9727 |
| 91 | Ga0466713_071386 | 3300042602 | Bacteria | 40802 |
| 92 | Ga0466713_105960 | 3300042602 | Bacteria | 3303 |
| 93 | Ga0466714_086953 | 3300042603 | Bacteria | 52249 |
| 94 | Ga0466735_122870 | 3300042624 | Bacteria | 8875 |
| 95 | Ga0466703_263478 | 3300042636 | Bacteria | 20336 |
| 96 | Ga0466708_365471 | 3300042652 | Bacteria | 12434 |
| 97 | Ga0160453_100177 | 3300012814 | Bacteria | 62248 |
| 98 | Ga0160441_100322 | 3300012825 | Bacteria | 43202 |
| 99 | Ga0160455_100068 | 3300012837 | Bacteria | 188813 |
| 100 | Ga0160447_100004 | 3300012849 | Bacteria | 554359 |
| 101 | 2226994264 | 2225789003 | Bacteria | 6763 |
| 102 | JGI24699J35502_11134159 | 3300002509 | Bacteria | 40635 |
| 103 | Ga0466713_030448 | 3300042602 | Bacteria | 41656 |
| 104 | Ga0466713_056825 | 3300042602 | Bacteria | 20190 |
| 105 | Ga0466704_155246 | 3300042643 | Bacteria | 56044 |
| 106 | Ga0466724_11764 | 3300042649 | Unclassified | 5118 |
| 107 | Ga0123354_10006490 | 3300010882 | Bacteria | 17390 |
| 108 | Ga0466718_167684 | 3300042617 | Bacteria | 8456 |
| 109 | Ga0160446_100002 | 3300012835 | Bacteria | 540874 |
| 110 | Ga0160460_100118 | 3300012845 | Bacteria | 101872 |
| 111 | Ga0160433_100059 | 3300012846 | Bacteria | 121476 |
| 112 | Ga0466696_175209 | 3300042596 | Bacteria | 8957 |
| 113 | Ga0104019_1189795 | 3300007150 | Bacteria | 3935 |
| 114 | Ga0466733_221074 | 3300042659 | Bacteria | 2302 |
| 115 | Ga0466716_330436 | 3300042605 | Bacteria | 29540 |
| 116 | Ga0466722_267593 | 3300042609 | Bacteria | 6212 |
| 117 | Ga0466735_163134 | 3300042624 | Bacteria | 2965 |
| 118 | Ga0466708_306065 | 3300042652 | Bacteria | 29067 |
| 119 | Ga0466727_106212 | 3300042655 | Bacteria | 8194 |
| 120 | Ga0123354_10009255 | 3300010882 | Bacteria | 15061 |
| 121 | Ga0466715_279782 | 3300042616 | Bacteria | 10388 |
| 122 | Ga0466728_055345 | 3300042620 | Bacteria | 34961 |
| 123 | Ga0466729_047723 | 3300042621 | Bacteria | 13388 |
| 124 | Ga0160455_100001 | 3300012837 | Bacteria | 1265300 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.