Protein Family IF11258
Metagenome
Isolate
183
Members
127
Samples
103
Scaffolds
207.52
Avg Length
Representative Sequence
- ID
- iso_pr_bacteria|2663763384|2666812845|
- Length
- 235 aa
- Sequence
- MEKLTKVTGVAVPLRRSSVDTDQIIPAVFLKRVAKTGFEDALFYAWRRDPEFILNQSRYANPRVLVAGPDFGIGSSREHAVWALRDYGFRVVISSKFADIFYGNTAKNGVLAAIMPQESVEEIWETLEANPGMSMSVDLKTRTATCGELTLPFQVDDYTCWRLMNGFDDIDLTLQHEADITAYEAERAQRFPFKPVTLPVMREPEQPVSSARPVDDSDWPGPIDSVDGDVSGGIA
Sample Types
Isolate
43.7%
Metagenome
56.3%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Unclassified
33.9%
Apidae
14.4%
Termitidae
11.0%
Kalotermitidae
7.6%
Scarabaeidae
5.1%
Formicidae
5.1%
Culicidae
4.2%
Cambaridae
3.4%
Hydrophilidae
2.5%
Tenebrionidae
2.5%
Armadillidiidae
2.5%
Rhinotermitidae
1.7%
Ixodidae
0.8%
Thomisidae
0.8%
Hodotermitidae
0.8%
Termopsidae
0.8%
Cerambycidae
0.8%
Pyralidae
0.8%
Curculionidae
0.8%
Taxonomy
Archaea
0
Bacteria
179
Eukaryota
0
Viruses
0
Unclassified
4
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 8110340172 | Bifidobacterium choladohabitans B14384H11 | Isolate | Apidae |
| 2 | 2821316722 | Unclassified Actinobacteria Lab288P1bin78 | Isolate | Unclassified |
| 3 | 2848356102 | Xylanimonas allomyrinae 2JSPR-7 | Isolate | Scarabaeidae |
| 4 | 2862075925 | Corynebacterium lactis S064 | Isolate | Ixodidae |
| 5 | 2519899775 | Bifidobacterium asteroides PRL2011 | Isolate | Apidae |
| 6 | 2597490239 | Bifidobacterium bohemicum DSM 22767 | Isolate | Unclassified |
| 7 | 2663763384 | Bifidobacterium bombi DSM 19703 | Isolate | Apidae |
| 8 | 2681812870 | Oerskovia enterophila DFA-19 | Isolate | Unclassified |
| 9 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 10 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 11 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 12 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 13 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 14 | 3300000333 | Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony | Metagenome | Apidae |
| 15 | 2820816657 | Unclassified Actinobacteria Nt197P3bin38 | Isolate | Unclassified |
| 16 | 2820901319 | Unclassified Actinobacteria Emb289P4bin58 | Isolate | Unclassified |
| 17 | 2820935937 | Unclassified Actinobacteria Emb289P1bin40 | Isolate | Unclassified |
| 18 | 2820944107 | Unclassified Actinobacteria Cu122P5bin14 | Isolate | Unclassified |
| 19 | 2856882415 | Pseudonocardia sp. Ae406_Ps2 | Isolate | Formicidae |
| 20 | 2873558832 | Propioniciclava coleopterorum HDW11 | Isolate | Hydrophilidae |
| 21 | 2873589062 | Phycicoccus sp. HDW14 | Isolate | Hydrophilidae |
| 22 | 2504756063 | Isoptericola variabilis J5 | Isolate | Unclassified |
| 23 | 2597490194 | Bifidobacterium coryneforme LMG 18911 | Isolate | Apidae |
| 24 | 2630969010 | Friedmanniella luteola DSM 21741 | Isolate | Thomisidae |
| 25 | 2671180601 | Bifidobacterium asteroides DSM 20089 | Isolate | Unclassified |
| 26 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 27 | 3300056857 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS (version 2) | Metagenome | Tenebrionidae |
| 28 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 29 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 30 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 31 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 32 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 33 | 8110341875 | Bifidobacterium polysaccharolyticum W8117 | Isolate | Apidae |
| 34 | 2820803007 | Unclassified Actinobacteria Th196P3bin61 | Isolate | Unclassified |
| 35 | 2820842553 | Unclassified Actinobacteria Lab288P4bin104 | Isolate | Unclassified |
| 36 | 2820929059 | Unclassified Actinobacteria Emb289P3bin110 | Isolate | Unclassified |
| 37 | 2821314491 | Unclassified Actinobacteria Lab288P4bin49 | Isolate | Unclassified |
| 38 | 2847305884 | Microbacterium protaetiae DFW100M-13 | Isolate | Scarabaeidae |
| 39 | 2856960404 | Pseudonocardia sp. Ae706_Ps2 | Isolate | Formicidae |
| 40 | 2856973192 | Pseudonocardia sp. Ae331_Ps2 | Isolate | Formicidae |
| 41 | 2859970369 | Pseudonocardia sp. Ae717_Ps2 | Isolate | Formicidae |
| 42 | 2909412500 | Yimella sp. cx-573 | Isolate | Cambaridae |
| 43 | 2931425734 | Nocardioides sp. J2M5 | Isolate | |
| 44 | 2931430189 | Tessaracoccus palaemonis J1M15 | Isolate | |
| 45 | 2518645556 | Nocardiopsis alba ATCC BAA-2165 | Isolate | Apidae |
| 46 | 2547132042 | Pseudonocardia sp. P2 | Isolate | Formicidae |
| 47 | 2772190761 | Rhodococcus rhodnii NRRL B-16535 | Isolate | Unclassified |
| 48 | 2808606957 | Bifidobacterium sp. ESL0447 | Isolate | Unclassified |
| 49 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 50 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 51 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 52 | 3300012824 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E11 MG | Metagenome | Armadillidiidae |
| 53 | 3300012831 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E6 MG | Metagenome | Culicidae |
| 54 | 3300012849 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG | Metagenome | Culicidae |
| 55 | 3300012850 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E0 MG | Metagenome | Culicidae |
| 56 | 2820834831 | Unclassified Actinobacteria Lab288P4bin79 | Isolate | Unclassified |
| 57 | 2883683260 | Protaetiibacter larvae KACC 19322 | Isolate | Scarabaeidae |
| 58 | 2888667245 | Corynebacterium diphtheriae FRC0190 | Isolate | Unclassified |
| 59 | 2915168811 | Leucobacter sp. cx-169 | Isolate | Cambaridae |
| 60 | 2568526170 | Bifidobacterium sp. A11 | Isolate | Apidae |
| 61 | 2600255079 | Bifidobacterium bombi DSM 19703 | Isolate | Apidae |
| 62 | 2684622919 | Bifidobacterium asteroides Bi_199 | Isolate | Unclassified |
| 63 | 2731957681 | Xylanimicrobium pachnodae JCM 13526, NBRC 107786 | Isolate | Scarabaeidae |
| 64 | 2818991320 | Klugiella xanthotipulae DSM 18031 | Isolate | Unclassified |
| 65 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 66 | 8024986378 | Bifidobacterium asteroides ESL0198 | Isolate | Apidae |
| 67 | 8032009961 | Bifidobacterium indicum ESL0197 | Isolate | Apidae |
| 68 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 69 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 70 | 3300012815 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E1 MG | Metagenome | |
| 71 | 2820825283 | Unclassified Actinobacteria Nt197P3bin111 | Isolate | Unclassified |
| 72 | 2820829137 | Unclassified Actinobacteria Nc150P5bin2 | Isolate | Unclassified |
| 73 | 2820894511 | Unclassified Actinobacteria Lab288P1bin103 | Isolate | Unclassified |
| 74 | 2820911766 | Unclassified Actinobacteria Emb289P3bin96 | Isolate | Unclassified |
| 75 | 2883361506 | Luteimicrobium xylanilyticum HY-24 | Isolate | Cerambycidae |
| 76 | 2660238275 | Bifidobacterium indicum DSM 20214 | Isolate | Unclassified |
| 77 | 2684622916 | Bifidobacterium asteroides Bi_170 | Isolate | Unclassified |
| 78 | 2684622917 | Bifidobacterium coryneforme Bi_197 | Isolate | Unclassified |
| 79 | 2693429521 | Bifidobacterium coryneforme DSM 20216 | Isolate | Unclassified |
| 80 | 2816332114 | Microbacterium saperdae DSM 20169 | Isolate | Unclassified |
| 81 | 8024982947 | Bifidobacterium asteroides ESL0200 | Isolate | Apidae |
| 82 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 83 | 3300012825 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E1 MG | Metagenome | |
| 84 | 3300012848 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG | Metagenome | Armadillidiidae |
| 85 | 3300012861 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E0 MG | Metagenome | Culicidae |
| 86 | 2820867525 | Unclassified Actinobacteria Lab288P3bin128 | Isolate | Unclassified |
| 87 | 2856954254 | Pseudonocardia sp. Ae505_Ps2 | Isolate | Formicidae |
| 88 | 2879643867 | Bifidobacterium sp. wkB344 | Isolate | Apidae |
| 89 | 2884351759 | Cellulosimicrobium sp. BI34T | Isolate | Pyralidae |
| 90 | 2684622920 | Bifidobacterium asteroides Bi_200 | Isolate | Unclassified |
| 91 | 2802429577 | Bifidobacterium indicum DSM 20214 | Isolate | Unclassified |
| 92 | 8062747827 | Yimella sp. cx-51 | Isolate | Cambaridae |
| 93 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 94 | 3300012806 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E1 MG | Metagenome | |
| 95 | 3300012812 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E11 MG | Metagenome | Culicidae |
| 96 | 3300012858 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG | Metagenome | Armadillidiidae |
| 97 | 8118075156 | Actinosynnema pretiosum DSM 44131 | Isolate | Unclassified |
| 98 | 2836973655 | Gryllotalpicola protaetiae 2DFW10M-5 | Isolate | Scarabaeidae |
| 99 | 2684622918 | Bifidobacterium asteroides Bi_198 | Isolate | Unclassified |
| 100 | 3300056790 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) | Metagenome | Tenebrionidae |
| 101 | 3300056856 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) | Metagenome | Tenebrionidae |
| 102 | 8024981139 | Bifidobacterium asteroides ESL0170 | Isolate | Apidae |
| 103 | 8024984606 | Bifidobacterium asteroides ESL0199 | Isolate | Apidae |
| 104 | 8069511479 | Arthrobacter ipsi IA7 | Isolate | Curculionidae |
| 105 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 106 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 107 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 108 | 3300012828 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E0 MG | Metagenome | |
| 109 | 3300012852 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E0 MG | Metagenome | |
| 110 | 2820845766 | Unclassified Actinobacteria Lab288P3bin96 | Isolate | Unclassified |
| 111 | 2820849606 | Unclassified Actinobacteria Lab288P3bin39 | Isolate | Unclassified |
| 112 | 2820926697 | Unclassified Actinobacteria Emb289P3bin125 | Isolate | Unclassified |
| 113 | 2824199081 | Bifidobacterium commune DSM 28792 | Isolate | Unclassified |
| 114 | 2837204985 | Lysinimonas sp. 2DFWR-13 | Isolate | Scarabaeidae |
| 115 | 2865982043 | Bifidobacterium aemilianum XV10 | Isolate | Apidae |
| 116 | 2873586004 | Sanguibacter sp. HDW7 | Isolate | Hydrophilidae |
| 117 | 2915166107 | Leucobacter sp. cx-87 | Isolate | Cambaridae |
| 118 | 2505679068 | Isoptericola variabilis 225 | Isolate | Unclassified |
| 119 | 2513237174 | Bifidobacterium asteroides ATCC 25910 | Isolate | Apidae |
| 120 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 121 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 122 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 123 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 124 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 125 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 126 | 3300012818 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E0 MG | Metagenome | |
| 127 | 3300012834 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E6 MG | Metagenome |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466733_012365 | 3300042659 | Bacteria | 3681 |
| 2 | Ga0562379_0657 | 3300056790 | Bacteria | 60108 |
| 3 | Ga0123357_10493890 | 3300009784 | Bacteria | 1023 |
| 4 | Ga0123356_10078988 | 3300010049 | Bacteria | 3107 |
| 5 | Ga0123353_10293309 | 3300010167 | Bacteria | 2488 |
| 6 | Ga0160441_100326 | 3300012825 | Bacteria | 42885 |
| 7 | Ga0160447_123749 | 3300012849 | Bacteria | 922 |
| 8 | Ga0466693_316369 | 3300042592 | Bacteria | 138024 |
| 9 | Ga0466730_011455 | 3300042625 | Bacteria | 1557 |
| 10 | Ga0466703_410962 | 3300042636 | Bacteria | 2064 |
| 11 | Ga0466704_230088 | 3300042643 | Bacteria | 3391 |
| 12 | Ga0466719_570799 | 3300042606 | Bacteria | 1189 |
| 13 | HBC_ctgsDRAFT_1001065 | 3300000333 | Unclassified | 5992 |
| 14 | JGI24705J35276_12225079 | 3300002504 | Bacteria | 2679 |
| 15 | JGI24699J35502_10976833 | 3300002509 | Bacteria | 1257 |
| 16 | Ga0466723_019168 | 3300042618 | Bacteria | 39538 |
| 17 | Ga0562379_0024 | 3300056790 | Bacteria | 850122 |
| 18 | Ga0562375_0610 | 3300056856 | Bacteria | 68256 |
| 19 | Ga0123355_10007341 | 3300009826 | Bacteria | 16504 |
| 20 | Ga0160432_101244 | 3300012818 | Bacteria | 8948 |
| 21 | Ga0160434_100564 | 3300012850 | Bacteria | 9323 |
| 22 | Ga0466730_025568 | 3300042625 | Bacteria | 2115 |
| 23 | Ga0466705_478343 | 3300042612 | Bacteria | 1847 |
| 24 | Ga0466729_107251 | 3300042621 | Bacteria | 8641 |
| 25 | Ga0466733_102585 | 3300042659 | Bacteria | 133807 |
| 26 | Ga0123355_11209948 | 3300009826 | Bacteria | 770 |
| 27 | Ga0123356_11110314 | 3300010049 | Bacteria | 959 |
| 28 | Ga0160471_106963 | 3300012812 | Bacteria | 1392 |
| 29 | Ga0160431_117631 | 3300012828 | Bacteria | 764 |
| 30 | Ga0466704_304461 | 3300042643 | Bacteria | 86696 |
| 31 | Ga0466713_061740 | 3300042602 | Bacteria | 13358 |
| 32 | Ga0466713_063438 | 3300042602 | Bacteria | 6645 |
| 33 | Ga0466713_102416 | 3300042602 | Bacteria | 18060 |
| 34 | Ga0466713_129388 | 3300042602 | Bacteria | 12811 |
| 35 | Ga0466713_151451 | 3300042602 | Bacteria | 19289 |
| 36 | Ga0466711_414168 | 3300042615 | Bacteria | 1053 |
| 37 | Ga0466705_169726 | 3300042612 | Bacteria | 3475 |
| 38 | Ga0562376_1701 | 3300056857 | Bacteria | 29631 |
| 39 | Ga0123355_10947955 | 3300009826 | Bacteria | 925 |
| 40 | Ga0123356_10299665 | 3300010049 | Bacteria | 1712 |
| 41 | Ga0123354_10112599 | 3300010882 | Bacteria | 3581 |
| 42 | Ga0160443_100254 | 3300012848 | Bacteria | 56034 |
| 43 | Ga0160434_100008 | 3300012850 | Bacteria | 308347 |
| 44 | Ga0466703_271360 | 3300042636 | Bacteria | 14472 |
| 45 | Ga0466704_103760 | 3300042643 | Bacteria | 3543 |
| 46 | Ga0466727_163659 | 3300042655 | Bacteria | 1157 |
| 47 | Ga0466706_181400 | 3300042599 | Bacteria | 2468 |
| 48 | Ga0466706_216103 | 3300042599 | Bacteria | 4950 |
| 49 | JGI24699J35502_11134221 | 3300002509 | Bacteria | 67001 |
| 50 | Ga0123357_10012362 | 3300009784 | Bacteria | 11011 |
| 51 | Ga0123355_10371131 | 3300009826 | Bacteria | 1874 |
| 52 | Ga0123356_10007197 | 3300010049 | Bacteria | 11134 |
| 53 | Ga0123354_10033583 | 3300010882 | Bacteria | 8030 |
| 54 | Ga0160443_100018 | 3300012848 | Bacteria | 423460 |
| 55 | Ga0160457_1001308 | 3300012858 | Bacteria | 7145 |
| 56 | Ga0466696_053399 | 3300042596 | Bacteria | 7447 |
| 57 | Ga0466704_374071 | 3300042643 | Bacteria | 11948 |
| 58 | Ga0466704_375651 | 3300042643 | Bacteria | 8247 |
| 59 | Ga0466724_46140 | 3300042649 | Bacteria | 630192 |
| 60 | Ga0466707_080865 | 3300042601 | Bacteria | 320076 |
| 61 | Ga0466713_027509 | 3300042602 | Bacteria | 2988 |
| 62 | Ga0466713_080871 | 3300042602 | Bacteria | 2802 |
| 63 | Ga0466713_152195 | 3300042602 | Bacteria | 13835 |
| 64 | HBC_ctgsDRAFT_1017532 | 3300000333 | Unclassified | 1744 |
| 65 | Ga0466723_102182 | 3300042618 | Bacteria | 14996 |
| 66 | Ga0466705_349855 | 3300042612 | Bacteria | 3448 |
| 67 | Ga0466733_078683 | 3300042659 | Bacteria | 25677 |
| 68 | Ga0123357_10118731 | 3300009784 | Bacteria | 3340 |
| 69 | Ga0123353_10080024 | 3300010167 | Bacteria | 5255 |
| 70 | Ga0123353_10146438 | 3300010167 | Bacteria | 3776 |
| 71 | Ga0160469_103054 | 3300012824 | Bacteria | 2561 |
| 72 | Ga0160452_100075 | 3300012834 | Bacteria | 131677 |
| 73 | Ga0466707_128435 | 3300042601 | Bacteria | 11615 |
| 74 | Ga0466715_591586 | 3300042616 | Bacteria | 26434 |
| 75 | Ga0466697_193707 | 3300042611 | Bacteria | 1426 |
| 76 | Ga0123356_10068572 | 3300010049 | Bacteria | 3323 |
| 77 | Ga0123356_10426160 | 3300010049 | Bacteria | 1470 |
| 78 | Ga0123356_10446394 | 3300010049 | Bacteria | 1441 |
| 79 | Ga0123354_10060498 | 3300010882 | Bacteria | 5601 |
| 80 | Ga0160440_102696 | 3300012815 | Bacteria | 1804 |
| 81 | Ga0160459_100623 | 3300012831 | Bacteria | 12696 |
| 82 | Ga0160447_101594 | 3300012849 | Bacteria | 8656 |
| 83 | Ga0160430_115056 | 3300012852 | Bacteria | 1179 |
| 84 | Ga0160436_1000032 | 3300012861 | Bacteria | 85402 |
| 85 | Ga0466696_133766 | 3300042596 | Bacteria | 10093 |
| 86 | Ga0466713_021406 | 3300042602 | Bacteria | 25571 |
| 87 | Ga0466722_016796 | 3300042609 | Bacteria | 3899 |
| 88 | Ga0466722_096989 | 3300042609 | Bacteria | 12413 |
| 89 | HBC_ctgsDRAFT_1030447 | 3300000333 | Unclassified | 1326 |
| 90 | Ga0123357_10000026 | 3300009784 | Bacteria | 128045 |
| 91 | Ga0123357_10000206 | 3300009784 | Bacteria | 55440 |
| 92 | Ga0466705_460805 | 3300042612 | Unclassified | 1013 |
| 93 | Ga0466723_132985 | 3300042618 | Bacteria | 1647 |
| 94 | Ga0562375_0088 | 3300056856 | Bacteria | 286142 |
| 95 | Ga0123353_10097543 | 3300010167 | Bacteria | 4737 |
| 96 | Ga0123353_10666738 | 3300010167 | Bacteria | 1468 |
| 97 | Ga0160442_100248 | 3300012806 | Bacteria | 37126 |
| 98 | Ga0160432_100056 | 3300012818 | Bacteria | 138739 |
| 99 | Ga0466713_082210 | 3300042602 | Bacteria | 22505 |
| 100 | Ga0466717_135740 | 3300042604 | Bacteria | 2183 |
| 101 | HBC_ctgsDRAFT_1015638 | 3300000333 | Bacteria | 1839 |
| 102 | Ga0466723_115132 | 3300042618 | Bacteria | 2451 |
| 103 | Ga0466728_345368 | 3300042620 | Bacteria | 2517 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00694 | Aconitase_C | Aconitase C-terminal domain | 1 | 113 | 0.92 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.