Protein Family IF11228

Metagenome Isolate
158 Members
84 Samples
109 Scaffolds
226.04 Avg Length

🧬 Representative Sequence

ID
iso_pr_bacteria|2648501322|2649446735|
Length
253 aa
Sequence
MRIAIAGAGAVGRSIAGELLENGHEVLLVDKTPTAISVERVPRAEWLLADACEITSLDEAALQRCNVVIAATGDDKVNLVVSLLAKTEYAVPRVVARVNNPKNEWLFNESWGVDVAVSTPRLMSALVEEAVSVGDLVRLLRFSHGDANLVELTLPPESELAGTRVGEVRWPEDTSLVTIIRGTRVLAPTVEDHLEAGDELLFVAAQSREEQLEALLSGRGDGVGAGGVVRPGGGVRGARAPGPPSSXXAPPPP

📊 Sample Types

Isolate 31.0%
Metagenome 69.0%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Unclassified 35.4%
Termitidae 21.5%
Kalotermitidae 15.2%
Formicidae 6.3%
Tenebrionidae 5.1%
Rhinotermitidae 3.8%
Cambaridae 3.8%
Thomisidae 1.3%
Hodotermitidae 1.3%
Elmidae 1.3%
Siricidae 1.3%
Termopsidae 1.3%
Curculionidae 1.3%
Reduviidae 1.3%

🌳 Taxonomy

Archaea 0
Bacteria 141
Eukaryota 0
Viruses 0
Unclassified 17

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2630969010 Friedmanniella luteola DSM 21741 Isolate Thomisidae
2 2648501322 Streptomyces sp. SA3_actF Isolate Unclassified
3 2820814774 Unclassified Actinobacteria Nt197P3bin39 Isolate Unclassified
4 2820935937 Unclassified Actinobacteria Emb289P1bin40 Isolate Unclassified
5 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
6 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
7 3300057007 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP_oats (version 2) Metagenome Tenebrionidae
8 8046957834 Streptomyces coacervatus JCM 17138 Isolate Unclassified
9 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
10 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
11 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
12 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
13 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
14 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
15 2820849606 Unclassified Actinobacteria Lab288P3bin39 Isolate Unclassified
16 2820889385 Unclassified Actinobacteria Lab288P1bin133 Isolate Unclassified
17 2820922474 Unclassified Actinobacteria Emb289P3bin154 Isolate Unclassified
18 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
19 8062637095 Yimella sp. cx-51 Isolate Cambaridae
20 8077783556 Streptomyces sp. PLM4 Isolate Formicidae
21 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
22 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
23 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
24 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
25 2820882373 Unclassified Actinobacteria Lab288P1bin45 Isolate Unclassified
26 2856652821 Actinomadura rubteroloni RB29 Isolate Unclassified
27 2864899338 Mycobacteroides chelonae S00154 Isolate Elmidae
28 2873196663 Streptomyces capitiformicae 1H-SSA4 Isolate Formicidae
29 2908241010 Streptomyces sp. HF10 Isolate Termitidae
30 2912817845 Streptomyces griseus SID164 Isolate
31 3300056790 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) Metagenome Tenebrionidae
32 3300056856 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) Metagenome Tenebrionidae
33 3006468911 Streptomyces sp. RB17 Isolate Termitidae
34 3300012852 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E0 MG Metagenome
35 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
36 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
37 2523533511 Streptomyces sp. Sv. ACTE SirexAA-E Isolate Siricidae
38 2820857933 Unclassified Actinobacteria Lab288P3bin173 Isolate Unclassified
39 2820863028 Unclassified Actinobacteria Lab288P3bin164 Isolate Unclassified
40 2820899690 Unclassified Actinobacteria Emb289P4bin9 Isolate Unclassified
41 2852016966 Micromonospora polyrhachis DSM 45886 Isolate Unclassified
42 2898589227 Actinomadura macrotermitis RB68 Isolate Termitidae
43 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
44 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
45 3300012805 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E11 MG Metagenome
46 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
47 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
48 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
49 2515154100 Streptomyces sp. MspMP-M5 Isolate Unclassified
50 2515154104 Streptomyces sp. KhCrAH-244 Isolate Unclassified
51 2821316722 Unclassified Actinobacteria Lab288P1bin78 Isolate Unclassified
52 2896955351 Streptomyces sp. GF20 Isolate Termitidae
53 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
54 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
55 647000328 Streptomyces sp. ACT-1 XylebKG-1 Isolate Curculionidae
56 8053361298 Streptomyces formicae 1H-GS9 Isolate Unclassified
57 8073544309 Actinomadura sp. RB99 Isolate Termitidae
58 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
59 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
60 2545824723 Rhodococcus rhodnii LMG 5362 Isolate Reduviidae
61 2547132081 Streptomyces sp. S4 Isolate Formicidae
62 2820911766 Unclassified Actinobacteria Emb289P3bin96 Isolate Unclassified
63 3300056842 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) Metagenome Tenebrionidae
64 8067071256 Microbispora camponoti 2C-HV3 Isolate Formicidae
65 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
66 2820867525 Unclassified Actinobacteria Lab288P3bin128 Isolate Unclassified
67 2912749649 Streptomyces sp. GS7 Isolate Termitidae
68 8062747827 Yimella sp. cx-51 Isolate Cambaridae
69 3006461590 Streptomyces sp. RB5 Isolate Termitidae
70 3006667155 Streptomyces sp. SID9727 Isolate
71 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
72 2515154106 Streptomyces sp. FxanaD5 Isolate Unclassified
73 2718217924 Pseudonocardia sp. HH130630-07 Isolate Formicidae
74 2772190761 Rhodococcus rhodnii NRRL B-16535 Isolate Unclassified
75 2820838073 Unclassified Actinobacteria Lab288P4bin27 Isolate Unclassified
76 2820842553 Unclassified Actinobacteria Lab288P4bin104 Isolate Unclassified
77 2820876581 Unclassified Actinobacteria Lab288P1bin83 Isolate Unclassified
78 2820929059 Unclassified Actinobacteria Emb289P3bin110 Isolate Unclassified
79 2862784999 Streptomyces sp. M41 Isolate Unclassified
80 2909412500 Yimella sp. cx-573 Isolate Cambaridae
81 2931425734 Nocardioides sp. J2M5 Isolate
82 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
83 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
84 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0562377_0089 3300056842 Bacteria 334543
2 Ga0562374_0370 3300057007 Unclassified 82894
3 Ga0160430_100023 3300012852 Bacteria 213821
4 Ga0466696_502927 3300042596 Bacteria 1771
5 Ga0466707_183290 3300042601 Bacteria 1346
6 Ga0466713_024393 3300042602 Bacteria 57144
7 Ga0466729_261188 3300042621 Bacteria 8846
8 Ga0466730_009923 3300042625 Unclassified 39383
9 Ga0466730_075687 3300042625 Bacteria 1555
10 Ga0466703_164152 3300042636 Bacteria 18213
11 Ga0466704_166380 3300042643 Bacteria 6160
12 Ga0466708_139236 3300042652 Bacteria 8356
13 Ga0466729_152417 3300042621 Bacteria 2435
14 Ga0562379_0008 3300056790 Bacteria 1928858
15 Ga0466692_033185 3300042591 Bacteria 2718
16 Ga0466707_252828 3300042601 Bacteria 1691
17 Ga0466707_345014 3300042601 Bacteria 1217
18 Ga0466713_032693 3300042602 Bacteria 139937
19 Ga0466713_063595 3300042602 Bacteria 12877
20 Ga0466719_126830 3300042606 Bacteria 53853
21 Ga0123357_10099996 3300009784 Bacteria 3743
22 Ga0123356_10008883 3300010049 Bacteria 9948
23 Ga0123356_10043527 3300010049 Unclassified 4181
24 Ga0123353_10600946 3300010167 Bacteria 1572
25 Ga0123353_10859317 3300010167 Unclassified 1242
26 Ga0123354_10002139 3300010882 Unclassified 25596
27 Ga0466705_201718 3300042612 Bacteria 8539
28 Ga0466730_003239 3300042625 Bacteria 3158
29 Ga0466703_221626 3300042636 Bacteria 46159
30 Ga0466704_291838 3300042643 Unclassified 4697
31 Ga0466723_090953 3300042618 Bacteria 11513
32 Ga0466728_333527 3300042620 Bacteria 2222
33 Ga0466692_170631 3300042591 Bacteria 3279
34 Ga0466713_069100 3300042602 Bacteria 3317
35 Ga0466722_188090 3300042609 Bacteria 1858
36 Ga0123357_10302749 3300009784 Bacteria 1612
37 Ga0123356_10016040 3300010049 Bacteria 7160
38 Ga0123354_10061568 3300010882 Unclassified 5537
39 Ga0466705_169625 3300042612 Unclassified 11247
40 Ga0466704_021875 3300042643 Unclassified 21856
41 Ga0466704_304310 3300042643 Bacteria 2176
42 Ga0466729_040130 3300042621 Bacteria 5784
43 Ga0466690_242197 3300042590 Bacteria 1693
44 Ga0466696_266100 3300042596 Bacteria 1082
45 Ga0123353_10059060 3300010167 Unclassified 6149
46 Ga0160464_108962 3300012805 Bacteria 932
47 JGI24702J35022_10110690 3300002462 Bacteria 1510
48 Ga0466703_151404 3300042636 Bacteria 56967
49 Ga0466703_255624 3300042636 Bacteria 18014
50 Ga0466727_235674 3300042655 Bacteria 2548
51 Ga0466711_498719 3300042615 Bacteria 1406
52 Ga0466723_183121 3300042618 Bacteria 4627
53 Ga0466723_270859 3300042618 Bacteria 11896
54 Ga0466728_009467 3300042620 Bacteria 1557
55 Ga0562375_1890 3300056856 Bacteria 25702
56 Ga0466706_273489 3300042599 Bacteria 4563
57 Ga0466713_001459 3300042602 Bacteria 7529
58 Ga0466713_125635 3300042602 Bacteria 4115
59 Ga0466697_031950 3300042611 Bacteria 2150
60 Ga0123355_10004847 3300009826 Unclassified 19583
61 Ga0123355_10186008 3300009826 Bacteria 3071
62 Ga0123356_10006286 3300010049 Bacteria 11998
63 Ga0123353_10000509 3300010167 Unclassified 48119
64 Ga0466705_002181 3300042612 Unclassified 4802
65 Ga0466730_029550 3300042625 Bacteria 4865
66 Ga0466730_055295 3300042625 Bacteria 36218
67 Ga0466730_074357 3300042625 Bacteria 1812
68 Ga0466703_302535 3300042636 Bacteria 6381
69 Ga0466711_147473 3300042615 Bacteria 1226
70 Ga0466715_098191 3300042616 Bacteria 12625
71 Ga0466723_268134 3300042618 Bacteria 19029
72 Ga0466691_121707 3300042593 Bacteria 1631
73 Ga0466706_009900 3300042599 Bacteria 12432
74 Ga0466713_120315 3300042602 Bacteria 1784
75 Ga0123356_10023737 3300010049 Bacteria 5770
76 Ga0123356_10609688 3300010049 Bacteria 1257
77 JGI24705J35276_12220509 3300002504 Bacteria 2272
78 Ga0466697_129720 3300042611 Bacteria 7814
79 Ga0466705_326546 3300042612 Bacteria 5538
80 Ga0466730_069639 3300042625 Bacteria 1055
81 Ga0466704_606659 3300042643 Bacteria 1410
82 Ga0466715_219611 3300042616 Bacteria 102424
83 Ga0466723_306432 3300042618 Bacteria 2277
84 Ga0466728_212762 3300042620 Bacteria 4057
85 Ga0562379_0272 3300056790 Bacteria 134461
86 Ga0466707_301133 3300042601 Bacteria 7676
87 Ga0466713_063930 3300042602 Bacteria 28203
88 Ga0466719_106946 3300042606 Bacteria 1218
89 Ga0123353_10214238 3300010167 Unclassified 3018
90 Ga0466705_017252 3300042612 Unclassified 4895
91 Ga0466730_018111 3300042625 Bacteria 4137
92 Ga0466730_075424 3300042625 Bacteria 1906
93 Ga0466703_264351 3300042636 Bacteria 8984
94 Ga0466727_304120 3300042655 Bacteria 5740
95 Ga0562375_0353 3300056856 Unclassified 106047
96 Ga0466691_224303 3300042593 Bacteria 5121
97 Ga0466696_231464 3300042596 Bacteria 3821
98 Ga0466696_234279 3300042596 Bacteria 1854
99 Ga0466707_001631 3300042601 Bacteria 3788
100 Ga0466707_331174 3300042601 Bacteria 2520
101 Ga0123357_10018658 3300009784 Bacteria 9227
102 Ga0123356_10002495 3300010049 Unclassified 19650
103 Ga0123354_10332687 3300010882 Bacteria 1382
104 Ga0466705_040116 3300042612 Bacteria 10801
105 Ga0466705_103407 3300042612 Bacteria 5901
106 Ga0466703_421407 3300042636 Bacteria 1810
107 Ga0466708_332784 3300042652 Bacteria 2455
108 Ga0466710_325646 3300042613 Bacteria 2072
109 Ga0466728_104022 3300042620 Bacteria 1604

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF02080 TrkA_C TrkA-C domain 149 216 0.97
PF02254 TrkA_N TrkA-N domain 3 118 0.96
PF02558 ApbA Ketopantoate reductase PanE/ApbA 3 33 0.9
PF13460 NAD_binding_10 NAD(P)H-binding 7 77 0.84
PF03807 F420_oxidored NADP oxidoreductase coenzyme F420-dependent 2 84 0.76
PF13241 NAD_binding_7 Putative NAD(P)-binding 2 89 0.73

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF02254 GO:0006813 potassium ion transport BP

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.