Protein Family IF11165
Metagenome
Isolate
138
Members
68
Samples
121
Scaffolds
337.65
Avg Length
Representative Sequence
- ID
- iso_pr_bacteria|2603880164|2606012254|
- Length
- 397 aa
- Sequence
- MAAKEDYYALLGVGKTATADELKKAYRKKAVQYHPDKNPGNKEAEEMFKKVSEAYDVLSDADKRAAYDRYGHAAFQGGMGGAGAGGFGGAGGGGFHDPFDIFREVFGRQAGGFSRAGGAGGGGFFDEMFGGGGGGRASAVRDGADLRYDLEITLEEAARGVEKEISYRRLVSCERCSGSGAEPGSKTVTCPTCGGAGQVRRSGGIITFTQVCPTCGGTGQKIEKPCTKCHGEGRVQQTTKLKVNIPAGVDTGSRLRSAGNGEAGVQGGQTGDLYIVLAVKEHELFERHGDDLFCEIPIKFTLATLGGSIEAPTLFGKATLKIPAGTQSGTTFRLREKGMPSLRGRRQGDQLVRVHVEVPTSLSNEQRKVLEEFATLSGDAPTEPASKSFFEKAKKFF
Sample Types
Isolate
12.3%
Metagenome
87.7%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Formicidae
25.4%
Unclassified
20.9%
Kalotermitidae
19.4%
Termitidae
11.9%
Blattidae
4.5%
Rhinotermitidae
4.5%
Termopsidae
4.5%
Passalidae
3.0%
Drosophilidae
3.0%
Hodotermitidae
1.5%
Tenebrionidae
1.5%
Taxonomy
Archaea
1
Bacteria
129
Eukaryota
0
Viruses
0
Unclassified
8
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 2 | 2940216256 | Dysgonomonadaceae bacterium PH5-43 | Isolate | Blattidae |
| 3 | 3300007083 | Ant gut microbial communities from Cephalotes persimilis, Brazil | Metagenome | Formicidae |
| 4 | 3300007140 | Ant gut microbial communities from Cephalotes pallens, Brazil | Metagenome | Formicidae |
| 5 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 6 | 2508501067 | Opitutaceae bacterium TAV1 | Isolate | Unclassified |
| 7 | 2639763186 | Opitutaceae bacterium TAV4 | Isolate | Unclassified |
| 8 | 2820751898 | Unclassified Bacteroidetes Nc150P4bin22 | Isolate | Unclassified |
| 9 | 2820811576 | Unclassified Actinobacteria Nt197P3bin53 | Isolate | Unclassified |
| 10 | 3300006995 | Ant gut microbial communities from Cephalotes angustus, Brazil | Metagenome | Formicidae |
| 11 | 3300007042 | Ant gut microbial communities from Cephalotes pusillus, Brazil | Metagenome | Formicidae |
| 12 | 3300007142 | Ant gut microbial communities from Cephalotes grandinosus, Brazil | Metagenome | Formicidae |
| 13 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 14 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 15 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 16 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 17 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 18 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 19 | 2639763185 | Opitutaceae bacterium TAV3 | Isolate | Unclassified |
| 20 | 2706794701 | Opitutaceae bacterium TSB47 | Isolate | Rhinotermitidae |
| 21 | 2687453757 | Opitutus sp. Cag34 | Isolate | Unclassified |
| 22 | 3300007129 | Ant gut microbial communities from Cephalotes atratus, Brazil | Metagenome | Formicidae |
| 23 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 24 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 25 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 26 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 27 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 28 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 29 | 2820813074 | Unclassified Actinobacteria Nt197P3bin52 | Isolate | Unclassified |
| 30 | 3300002931 | Ant worker gut metagenome for colony PL010 | Metagenome | Formicidae |
| 31 | 3300002934 | Ant worker gut metagenome for colony PL005 | Metagenome | Formicidae |
| 32 | 3300007080 | Ant gut microbial communities from Cephalotes clypeatus, Brazil | Metagenome | Formicidae |
| 33 | 3300007153 | Drosophila gut microbial communities from New York, USA - Drosophila putrida male 3 gut | Metagenome | Drosophilidae |
| 34 | 3300007190 | Ant gut microbial communities from Cephalotes umbraculatus, Peru | Metagenome | Formicidae |
| 35 | 3300007192 | Ant gut microbial communities from Cephalotes persimplex, Brazil | Metagenome | Formicidae |
| 36 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 37 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 38 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 39 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 40 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 41 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 42 | 2517572100 | Geminisphaera colitermitum TAV2 | Isolate | Unclassified |
| 43 | 2857498920 | Opitutaceae bacterium TAV4 | Isolate | Unclassified |
| 44 | 2940239174 | Ereboglobus sp. PH5-10 | Isolate | Blattidae |
| 45 | 3300007067 | Ant gut microbial communities from Cephalotes spinosus, Peru | Metagenome | Formicidae |
| 46 | 3300007068 | Ant gut microbial communities from Cephalotes simillimus, Peru | Metagenome | Formicidae |
| 47 | 3300007139 | Ant gut microbial communities from Cephalotes pellans, Brazil | Metagenome | Formicidae |
| 48 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 49 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
| 50 | 2820776227 | Unclassified Bacteroidetes Emb289P4bin3 | Isolate | Unclassified |
| 51 | 2857493320 | Opitutaceae bacterium TAV3 | Isolate | Unclassified |
| 52 | 2820906387 | Unclassified Actinobacteria Emb289P4bin41 | Isolate | Unclassified |
| 53 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 54 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 55 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 56 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 57 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 58 | 2603880164 | Opitutus sp. | Isolate | Formicidae |
| 59 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 60 | 3300007095 | Ant gut microbial communities from Cephalotes minutus, Brazil | Metagenome | Formicidae |
| 61 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 62 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 63 | 2940377351 | Ereboglobus sp. PH5-5 | Isolate | Blattidae |
| 64 | 3300007085 | Drosophila gut microbial communities from New York, USA - Drosophila neotestacea male 3 gut | Metagenome | Drosophilidae |
| 65 | 3300007141 | Ant gut microbial communities from Cephalotes maculatus, Brazil | Metagenome | Formicidae |
| 66 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 67 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 68 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_262622 | 3300042612 | Bacteria | 4220 |
| 2 | Ga0466733_172514 | 3300042659 | Bacteria | 11636 |
| 3 | Ga0466715_086437 | 3300042616 | Bacteria | 16007 |
| 4 | Ga0466715_429127 | 3300042616 | Bacteria | 34182 |
| 5 | Ga0466715_596057 | 3300042616 | Bacteria | 23706 |
| 6 | Ga0104050_1004850 | 3300007153 | Bacteria | 3291 |
| 7 | Ga0466735_041953 | 3300042624 | Bacteria | 1749 |
| 8 | Ga0466735_054936 | 3300042624 | Bacteria | 4381 |
| 9 | Ga0466703_078154 | 3300042636 | Archaea | 2950 |
| 10 | Ga0466704_052028 | 3300042643 | Bacteria | 20029 |
| 11 | Ga0466704_312462 | 3300042643 | Bacteria | 44651 |
| 12 | Ga0466709_134907 | 3300042648 | Bacteria | 4477 |
| 13 | Ga0466705_235326 | 3300042612 | Unclassified | 6180 |
| 14 | Ga0562377_0489 | 3300056842 | Bacteria | 63744 |
| 15 | Ga0466728_060083 | 3300042620 | Bacteria | 86084 |
| 16 | Ga0123357_10169265 | 3300009784 | Unclassified | 2590 |
| 17 | Ga0264413_111800 | 3300024493 | Bacteria | 5591 |
| 18 | Ga0466690_080108 | 3300042590 | Bacteria | 3393 |
| 19 | Ga0466693_001425 | 3300042592 | Bacteria | 3268 |
| 20 | Ga0466716_259391 | 3300042605 | Bacteria | 2342 |
| 21 | Ga0466716_375904 | 3300042605 | Bacteria | 1484 |
| 22 | IMNBL1DRAFT_c0000056 | 3300000062 | Bacteria | 106919 |
| 23 | CVPL005W_1001666 | 3300002934 | Bacteria | 9874 |
| 24 | Ga0103263_100006 | 3300007042 | Bacteria | 115589 |
| 25 | Ga0103265_1000644 | 3300007068 | Bacteria | 7593 |
| 26 | Ga0102735_1000252 | 3300007080 | Bacteria | 13057 |
| 27 | Ga0104050_1199771 | 3300007153 | Unclassified | 3926 |
| 28 | Ga0466703_261354 | 3300042636 | Bacteria | 14575 |
| 29 | Ga0466704_372968 | 3300042643 | Bacteria | 3080 |
| 30 | Ga0466704_537240 | 3300042643 | Bacteria | 12055 |
| 31 | Ga0466705_307210 | 3300042612 | Bacteria | 6433 |
| 32 | Ga0466715_069350 | 3300042616 | Bacteria | 3359 |
| 33 | Ga0123357_10058263 | 3300009784 | Bacteria | 5187 |
| 34 | Ga0466707_084177 | 3300042601 | Bacteria | 2625 |
| 35 | Ga0466714_041834 | 3300042603 | Bacteria | 2417 |
| 36 | Ga0466716_151805 | 3300042605 | Bacteria | 4571 |
| 37 | Ga0466716_482844 | 3300042605 | Bacteria | 7159 |
| 38 | Ga0466722_231619 | 3300042609 | Bacteria | 16785 |
| 39 | IMNBL1DRAFT_c0013283 | 3300000062 | Bacteria | 3706 |
| 40 | Ga0102734_1000043 | 3300007129 | Bacteria | 63175 |
| 41 | Ga0466703_093472 | 3300042636 | Bacteria | 6192 |
| 42 | Ga0466705_033631 | 3300042612 | Bacteria | 25543 |
| 43 | Ga0466726_017447 | 3300042619 | Bacteria | 18731 |
| 44 | Ga0466707_155807 | 3300042601 | Bacteria | 4313 |
| 45 | Ga0466716_111154 | 3300042605 | Bacteria | 5914 |
| 46 | Ga0466722_068012 | 3300042609 | Bacteria | 9499 |
| 47 | Ga0466722_195109 | 3300042609 | Bacteria | 7295 |
| 48 | Ga0102734_1000059 | 3300007129 | Bacteria | 52186 |
| 49 | Ga0102737_1000052 | 3300007142 | Bacteria | 34662 |
| 50 | Ga0103268_1001961 | 3300007192 | Bacteria | 4777 |
| 51 | Ga0466735_077202 | 3300042624 | Bacteria | 1659 |
| 52 | Ga0466703_370181 | 3300042636 | Bacteria | 7552 |
| 53 | Ga0466715_026465 | 3300042616 | Bacteria | 99999 |
| 54 | Ga0466723_167305 | 3300042618 | Bacteria | 23666 |
| 55 | Ga0466726_381165 | 3300042619 | Bacteria | 2931 |
| 56 | Ga0466690_067915 | 3300042590 | Bacteria | 15818 |
| 57 | Ga0466706_074239 | 3300042599 | Bacteria | 7384 |
| 58 | Ga0466716_279769 | 3300042605 | Bacteria | 3951 |
| 59 | Ga0466719_382483 | 3300042606 | Bacteria | 1952 |
| 60 | Ga0104045_1075423 | 3300007085 | Bacteria | 1990 |
| 61 | Ga0103267_1000560 | 3300007190 | Unclassified | 11375 |
| 62 | Ga0466735_220272 | 3300042624 | Bacteria | 2445 |
| 63 | Ga0466704_051739 | 3300042643 | Bacteria | 4346 |
| 64 | Ga0466704_081630 | 3300042643 | Bacteria | 8390 |
| 65 | Ga0466704_310195 | 3300042643 | Bacteria | 11153 |
| 66 | Ga0466733_076202 | 3300042659 | Bacteria | 12480 |
| 67 | Ga0466723_003602 | 3300042618 | Bacteria | 21190 |
| 68 | Ga0466691_024388 | 3300042593 | Bacteria | 47184 |
| 69 | Ga0466696_501820 | 3300042596 | Bacteria | 22424 |
| 70 | Ga0466717_196260 | 3300042604 | Bacteria | 2998 |
| 71 | Ga0103261_1000034 | 3300007083 | Bacteria | 80537 |
| 72 | Ga0102740_1000310 | 3300007140 | Bacteria | 13728 |
| 73 | Ga0103267_1003964 | 3300007190 | Bacteria | 3990 |
| 74 | Ga0466735_153666 | 3300042624 | Bacteria | 1849 |
| 75 | Ga0466704_221653 | 3300042643 | Bacteria | 14003 |
| 76 | Ga0466704_526105 | 3300042643 | Bacteria | 5708 |
| 77 | Ga0466708_149731 | 3300042652 | Bacteria | 34671 |
| 78 | Ga0466705_107222 | 3300042612 | Bacteria | 12906 |
| 79 | Ga0466726_162695 | 3300042619 | Bacteria | 7094 |
| 80 | Ga0466728_234738 | 3300042620 | Bacteria | 7792 |
| 81 | Ga0123357_10019192 | 3300009784 | Bacteria | 9106 |
| 82 | Ga0466690_038577 | 3300042590 | Bacteria | 6658 |
| 83 | Ga0466696_443384 | 3300042596 | Bacteria | 7343 |
| 84 | Ga0466696_500508 | 3300042596 | Bacteria | 25765 |
| 85 | Ga0466701_064830 | 3300042598 | Bacteria | 186218 |
| 86 | Ga0466713_004248 | 3300042602 | Bacteria | 2064 |
| 87 | Ga0466713_094826 | 3300042602 | Bacteria | 1722 |
| 88 | 2227646816 | 2225789004 | Bacteria | 44589 |
| 89 | CVPL010W_10005463 | 3300002931 | Bacteria | 14719 |
| 90 | Ga0102733_100039 | 3300006995 | Unclassified | 18084 |
| 91 | Ga0103266_1000044 | 3300007067 | Bacteria | 89495 |
| 92 | Ga0102735_1000157 | 3300007080 | Bacteria | 17754 |
| 93 | Ga0103260_1000149 | 3300007139 | Unclassified | 18527 |
| 94 | Ga0102738_1000007 | 3300007141 | Bacteria | 181972 |
| 95 | Ga0104050_1026371 | 3300007153 | Bacteria | 4164 |
| 96 | Ga0466735_135971 | 3300042624 | Bacteria | 2664 |
| 97 | Ga0466703_098138 | 3300042636 | Bacteria | 16409 |
| 98 | Ga0466703_292751 | 3300042636 | Bacteria | 18329 |
| 99 | Ga0466703_395437 | 3300042636 | Bacteria | 3382 |
| 100 | Ga0466704_102388 | 3300042643 | Bacteria | 7877 |
| 101 | Ga0466704_175821 | 3300042643 | Bacteria | 21678 |
| 102 | Ga0466727_123803 | 3300042655 | Bacteria | 15231 |
| 103 | Ga0466705_030269 | 3300042612 | Bacteria | 34132 |
| 104 | Ga0466715_092286 | 3300042616 | Bacteria | 33475 |
| 105 | Ga0466723_029074 | 3300042618 | Bacteria | 104983 |
| 106 | Ga0466728_132021 | 3300042620 | Bacteria | 10419 |
| 107 | Ga0466728_169008 | 3300042620 | Bacteria | 25778 |
| 108 | Ga0466728_451525 | 3300042620 | Bacteria | 7599 |
| 109 | Ga0123357_10004524 | 3300009784 | Bacteria | 16353 |
| 110 | Ga0123353_10245394 | 3300010167 | Bacteria | 2779 |
| 111 | Ga0466690_392447 | 3300042590 | Bacteria | 51684 |
| 112 | Ga0466692_075181 | 3300042591 | Bacteria | 9420 |
| 113 | Ga0466691_007830 | 3300042593 | Bacteria | 3638 |
| 114 | Ga0466706_097459 | 3300042599 | Unclassified | 1354 |
| 115 | Ga0466722_052788 | 3300042609 | Bacteria | 26696 |
| 116 | JGI24702J35022_10001343 | 3300002462 | Bacteria | 15286 |
| 117 | Ga0104045_1023463 | 3300007085 | Unclassified | 3514 |
| 118 | Ga0102739_1000017 | 3300007095 | Bacteria | 58340 |
| 119 | Ga0103267_1024263 | 3300007190 | Bacteria | 2014 |
| 120 | Ga0466704_207486 | 3300042643 | Bacteria | 7711 |
| 121 | Ga0466704_402657 | 3300042643 | Bacteria | 3440 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.