Protein Family IF10649

Metagenome Metatranscriptome Isolate
279 Members
73 Samples
255 Scaffolds
260.47 Avg Length

🧬 Representative Sequence

ID
3300056857|Ga0562376_3886|Ga0562376_3886_818_1651
Length
277 aa
Sequence
MIIKARRELCIIMMRSLWTGASGMNGQQVNIDTISNNLANVNTTGYKPVRAEFEDLLYQTQRIAGTPATDLTSRPLGVQVGHGVKVSATQRLFDQGSLQATGNTTDVAITGEGFLRVQLIDGSYAYTRDGSLKIDSNGQLVSNQGYRVQPEIIFPENFIRDTITVSTQGEVTVKIPGQDDPVTVGQLELYRFVNPAGLAPLGENLFKENQASGEVVSGLPGQDGMGQLQHKFLEMSAVSSIQEMVNLIVAQRAYEFNSKTVQTSDNMLGTATQLKRS

πŸ“Š Sample Types

Isolate 8.6%
Metagenome 90.7%
MAG 0.0%
Metatranscriptome 0.7%
Single Cell 0.0%

πŸ› Taxa Family Distribution

Termitidae 34.8%
Unclassified 23.2%
Kalotermitidae 18.8%
Culicidae 11.6%
Termopsidae 4.3%
Tenebrionidae 2.9%
Rhinotermitidae 2.9%
Hodotermitidae 1.4%

🌳 Taxonomy

Archaea 1
Bacteria 230
Eukaryota 0
Viruses 0
Unclassified 48

πŸ—‚οΈ Samples

#Sample IDDescriptionTypeTaxa Family
1 2964266314 Entomospira nematocera BR208 Isolate Culicidae
2 2781125638 Treponema sp. Co191P1bin8 Isolate Unclassified
3 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
4 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
5 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
6 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
7 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
8 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
9 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
10 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
11 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
12 2964145936 Entomospira culicis BR149 Isolate Culicidae
13 2781125687 Treponema sp. Lab288P4bin29 Isolate Unclassified
14 3300056857 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS (version 2) Metagenome Tenebrionidae
15 3300057007 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP_oats (version 2) Metagenome Tenebrionidae
16 8063587521 Entomospira entomophilus BR193 Isolate Culicidae
17 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
18 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
19 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
20 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
21 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
22 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
23 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
24 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
25 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
26 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
27 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
28 2964130733 Entomospira entomophilus BR193 Isolate Culicidae
29 2781125642 Treponema sp. Co191P1bin35 Isolate Unclassified
30 2781125646 Treponema sp. Co191P3bin59 Isolate Unclassified
31 2781125659 Treponema sp. Emb289P3bin114 Isolate Unclassified
32 2964144231 Entomospira culicis BR151 Isolate Culicidae
33 2781125664 Treponema sp. Emb289P3bin139 Isolate Unclassified
34 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
35 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
36 3300021235 Termite gut microbial communities from nest from French Guiana - FG16_2_6 mRNA SA Metatranscriptome
37 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
38 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
39 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
40 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
41 2781125644 Treponema sp. Co191P3bin12 Isolate Unclassified
42 2781125663 Treponema sp. Emb289P3bin135 Isolate Unclassified
43 2781125665 Treponema sp. Emb289P3bin117 Isolate Unclassified
44 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
45 8063589291 Entomospira nematocera BR208 Isolate Culicidae
46 8063597228 Entomospira culicis BR151 Isolate Culicidae
47 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
48 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
49 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
50 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
51 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
52 2740892545 Fibrobacteria bacterium GUT31 IN01_31 Isolate Unclassified
53 8063595521 Entomospira culicis BR149 Isolate Culicidae
54 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
55 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
56 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
57 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
58 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
59 2781125636 Treponema sp. Co191P1bin67 Isolate Unclassified
60 2820020240 Unclassified Spirochaetes Nc150P3bin10 Isolate Unclassified
61 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
62 3300001880 Termite hindgut microbial communities from the Max Planck Institute, Bremen, Germany, analyzing fibers in the hindgut lumen - ASSEMBLED Fiber-Associated Metagenome Metagenome
63 3300022815 Termite gut microbial communities from Microcerotermes sp. nest - French Guiana - 27-16 mRNA Metatranscriptome Termitidae
64 2228664003 P3 Gut Segment Termite Single Cell Genome_Treponema sp. T4b from Florida, USA Metagenome Termitidae
65 2781125634 Treponema sp. Co191P1bin45 Isolate Unclassified
66 2820025825 Unclassified Spirochaetes Lab288P1bin8 Isolate Unclassified
67 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
68 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
69 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
70 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
71 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
72 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
73 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae

πŸ”— Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_014472 3300042612 Bacteria 4321
2 Ga0466733_039596 3300042659 Bacteria 2607
3 Ga0466733_103298 3300042659 Bacteria 18011
4 Ga0466733_109951 3300042659 Bacteria 100756
5 Ga0415639_048583 3300038395 Bacteria 3371
6 Ga0466692_043680 3300042591 Bacteria 1634
7 Ga0466694_212256 3300042594 Bacteria 1578
8 Ga0466696_137497 3300042596 Bacteria 9032
9 Ga0466699_080308 3300042597 Bacteria 6391
10 Ga0123356_10000609 3300010049 Bacteria 39509
11 Ga0123356_10010644 3300010049 Bacteria 9003
12 Ga0123356_10390141 3300010049 Bacteria 1527
13 Ga0466706_264438 3300042599 Bacteria 25507
14 Ga0466707_090616 3300042601 Unclassified 9620
15 Ga0466719_109212 3300042606 Bacteria 39694
16 Ga0466720_039004 3300042607 Bacteria 3930
17 Ga0466720_224066 3300042607 Bacteria 4230
18 Ga0466711_138840 3300042615 Bacteria 14079
19 Ga0466718_041632 3300042617 Bacteria 3720
20 Ga0466718_067874 3300042617 Bacteria 57908
21 Ga0466723_097952 3300042618 Unclassified 1394
22 Ga0466723_203507 3300042618 Unclassified 11557
23 Ga0466723_208396 3300042618 Unclassified 10254
24 Ga0466726_402401 3300042619 Bacteria 5167
25 Ga0466728_222215 3300042620 Bacteria 4883
26 Ga0466728_314097 3300042620 Unclassified 1939
27 Ga0466702_053346 3300042635 Unclassified 3917
28 Ga0466702_073385 3300042635 Unclassified 1000
29 Ga0466702_304002 3300042635 Bacteria 20651
30 Ga0466702_308151 3300042635 Bacteria 1360
31 Ga0466703_149800 3300042636 Bacteria 3723
32 Ga0466703_357215 3300042636 Bacteria 5489
33 Ga0466704_361352 3300042643 Unclassified 2661
34 JGI24698J34947_10005456 3300002449 Bacteria 6981
35 JGI24698J34947_10024784 3300002449 Bacteria 3199
36 JGI24695J34938_10000568 3300002450 Bacteria 35544
37 JGI24695J34938_10020101 3300002450 Bacteria 3292
38 JGI24695J34938_10022673 3300002450 Bacteria 3042
39 Ga0072941_1002833 3300005201 Bacteria 36326
40 Ga0466732_051659 3300042656 Bacteria 1645
41 Ga0466690_118221 3300042590 Bacteria 39842
42 Ga0466693_035558 3300042592 Bacteria 8542
43 Ga0466691_109781 3300042593 Bacteria 6037
44 Ga0466694_187972 3300042594 Bacteria 15406
45 Ga0466694_292156 3300042594 Bacteria 3420
46 Ga0466696_328618 3300042596 Bacteria 11340
47 Ga0123356_10000788 3300010049 Bacteria 35154
48 Ga0123356_10012702 3300010049 Bacteria 8159
49 Ga0123356_10019626 3300010049 Bacteria 6405
50 Ga0123354_10132062 3300010882 Bacteria 3147
51 Ga0466700_421675 3300042600 Bacteria 2061
52 Ga0466716_028500 3300042605 Bacteria 39046
53 Ga0466716_128564 3300042605 Bacteria 29032
54 Ga0466716_502074 3300042605 Unclassified 8984
55 Ga0466719_027141 3300042606 Bacteria 7686
56 Ga0466720_083301 3300042607 Bacteria 8629
57 Ga0466705_447414 3300042612 Bacteria 3225
58 Ga0466712_027725 3300042614 Bacteria 34997
59 Ga0466715_095204 3300042616 Bacteria 3908
60 Ga0466715_180715 3300042616 Bacteria 30092
61 Ga0466718_054626 3300042617 Unclassified 1630
62 Ga0466723_036462 3300042618 Bacteria 18899
63 Ga0466723_138127 3300042618 Bacteria 8692
64 Ga0466726_044224 3300042619 Bacteria 2528
65 Ga0466728_063555 3300042620 Unclassified 1787
66 Ga0466731_141280 3300042622 Bacteria 1536
67 Ga0466703_100737 3300042636 Bacteria 12293
68 Ga0466704_149345 3300042643 Unclassified 3569
69 Ga0466704_508526 3300042643 Unclassified 1250
70 Ga0466704_562463 3300042643 Bacteria 1511
71 Ga0466727_343381 3300042655 Bacteria 1198
72 FAAS_10005177 3300001880 Unclassified 1844
73 JGI24698J34947_10000007 3300002449 Bacteria 54610
74 JGI24695J34938_10002104 3300002450 Bacteria 15603
75 JGI24695J34938_10004581 3300002450 Bacteria 9005
76 JGI24695J34938_10004822 3300002450 Bacteria 8672
77 Ga0072941_1002830 3300005201 Bacteria 61182
78 Ga0072941_1005181 3300005201 Bacteria 14850
79 Ga0466705_356671 3300042612 Bacteria 2333
80 Ga0466733_090552 3300042659 Unclassified 1204
81 Ga0466733_168021 3300042659 Bacteria 1408
82 Ga0562374_0009 3300057007 Bacteria 1987311
83 Ga0466690_359805 3300042590 Unclassified 2390
84 Ga0466691_021989 3300042593 Unclassified 2196
85 Ga0466691_022042 3300042593 Bacteria 10751
86 Ga0466694_204367 3300042594 Bacteria 29137
87 Ga0466696_163464 3300042596 Bacteria 16967
88 Ga0123356_10040895 3300010049 Bacteria 4319
89 Ga0466706_053099 3300042599 Bacteria 6467
90 Ga0466706_219015 3300042599 Bacteria 1819
91 Ga0466716_547161 3300042605 Unclassified 1252
92 Ga0466719_256372 3300042606 Bacteria 2573
93 Ga0466705_453818 3300042612 Unclassified 2378
94 Ga0466712_101152 3300042614 Bacteria 19189
95 Ga0466712_170515 3300042614 Bacteria 11156
96 Ga0466718_062692 3300042617 Bacteria 4020
97 Ga0466718_075646 3300042617 Unclassified 8056
98 Ga0466718_088271 3300042617 Bacteria 5356
99 Ga0466718_095301 3300042617 Bacteria 25433
100 Ga0466723_166974 3300042618 Bacteria 22668
101 Ga0466726_031632 3300042619 Bacteria 1280
102 Ga0466726_048821 3300042619 Bacteria 8968
103 Ga0466731_388856 3300042622 Bacteria 12781
104 Ga0466735_035560 3300042624 Bacteria 9001
105 Ga0466704_156935 3300042643 Bacteria 7102
106 AustNasuHG_c1000216 3300000089 Bacteria 19218
107 JGI24698J34947_10002218 3300002449 Bacteria 10408
108 JGI24698J34947_10004182 3300002449 Unclassified 7844
109 JGI24698J34947_10052683 3300002449 Bacteria 2041
110 JGI24695J34938_10002966 3300002450 Bacteria 12233
111 JGI24695J34938_10004238 3300002450 Unclassified 9514
112 JGI24699J35502_11132356 3300002509 Unclassified 6740
113 Ga0072941_1016066 3300005201 Unclassified 11549
114 Ga0072941_1018670 3300005201 Bacteria 12699
115 Ga0466705_172688 3300042612 Bacteria 13303
116 Ga0466733_059144 3300042659 Bacteria 3242
117 Ga0466733_219881 3300042659 Bacteria 13955
118 Ga0223674_1018744 3300021235 Unclassified 2943
119 Ga0255786_1003212 3300022815 Bacteria 1547
120 Ga0466690_182233 3300042590 Unclassified 3744
121 Ga0466691_201235 3300042593 Bacteria 22831
122 Ga0466696_165486 3300042596 Bacteria 11333
123 Ga0466699_291822 3300042597 Bacteria 1335
124 Ga0123356_10277917 3300010049 Bacteria 1768
125 Ga0123353_10983139 3300010167 Bacteria 1137
126 Ga0466707_059982 3300042601 Bacteria 1593
127 Ga0466707_079023 3300042601 Bacteria 1406
128 Ga0466719_224215 3300042606 Bacteria 18583
129 Ga0466705_456557 3300042612 Unclassified 4381
130 Ga0466718_150108 3300042617 Unclassified 2980
131 Ga0466723_014582 3300042618 Bacteria 8508
132 Ga0466723_164428 3300042618 Bacteria 8703
133 Ga0466728_137680 3300042620 Bacteria 7145
134 Ga0466703_216587 3300042636 Bacteria 14068
135 Ga0466727_284229 3300042655 Bacteria 1296
136 JGI24698J34947_10031389 3300002449 Bacteria 2797
137 JGI24698J34947_10037338 3300002449 Bacteria 2524
138 JGI24698J34947_10055644 3300002449 Unclassified 1970
139 JGI24698J34947_10073192 3300002449 Bacteria 1636
140 JGI24695J34938_10000894 3300002450 Bacteria 27547
141 Ga0264413_101799 3300024493 Bacteria 45782
142 Ga0466694_329220 3300042594 Bacteria 28665
143 Ga0123356_10038087 3300010049 Bacteria 4482
144 Ga0466706_170632 3300042599 Bacteria 2237
145 Ga0466706_178179 3300042599 Bacteria 4698
146 Ga0466700_262847 3300042600 Bacteria 4294
147 Ga0466700_428850 3300042600 Unclassified 1209
148 Ga0466707_302694 3300042601 Bacteria 2153
149 Ga0466720_085412 3300042607 Bacteria 8065
150 Ga0466721_154118 3300042608 Bacteria 8683
151 Ga0466722_026349 3300042609 Bacteria 26042
152 Ga0466722_155764 3300042609 Bacteria 4196
153 Ga0466698_247993 3300042610 Bacteria 1647
154 Ga0466718_012050 3300042617 Unclassified 2730
155 Ga0466718_035605 3300042617 Bacteria 20271
156 Ga0466723_349503 3300042618 Bacteria 2617
157 Ga0466726_003516 3300042619 Bacteria 6642
158 Ga0466726_027325 3300042619 Bacteria 1143
159 Ga0466726_169410 3300042619 Bacteria 1122
160 Ga0466728_242932 3300042620 Unclassified 1645
161 Ga0466702_005456 3300042635 Bacteria 4495
162 AustNasuHG_c1000693 3300000089 Bacteria 11967
163 AustNasuHG_c1014070 3300000089 Bacteria 2730
164 JGI24698J34947_10020812 3300002449 Bacteria 3532
165 JGI24695J34938_10001516 3300002450 Bacteria 19556
166 Ga0466705_342511 3300042612 Bacteria 2711
167 Ga0466733_103978 3300042659 Unclassified 2402
168 Ga0562376_3886 3300056857 Bacteria 13917
169 Ga0415639_064474 3300038395 Bacteria 2078
170 Ga0123356_10046845 3300010049 Bacteria 4022
171 Ga0123356_10786701 3300010049 Bacteria 1122
172 Ga0466707_316206 3300042601 Bacteria 1966
173 Ga0466707_415071 3300042601 Bacteria 1127
174 Ga0466713_033187 3300042602 Bacteria 1727
175 Ga0466716_014361 3300042605 Bacteria 1401
176 Ga0466719_076283 3300042606 Unclassified 1158
177 Ga0466719_194890 3300042606 Bacteria 6381
178 Ga0466698_096614 3300042610 Bacteria 39797
179 Ga0466705_388583 3300042612 Unclassified 16167
180 Ga0466712_132713 3300042614 Unclassified 2041
181 Ga0466712_133718 3300042614 Bacteria 3522
182 Ga0466712_139692 3300042614 Bacteria 15387
183 Ga0466711_253343 3300042615 Bacteria 6270
184 Ga0466718_052607 3300042617 Archaea 1788
185 Ga0466718_053171 3300042617 Bacteria 1307
186 Ga0466726_046874 3300042619 Bacteria 2607
187 Ga0466735_112729 3300042624 Bacteria 2012
188 Ga0466702_317922 3300042635 Bacteria 1068
189 Ga0466704_328633 3300042643 Unclassified 6950
190 Ga0466704_480733 3300042643 Bacteria 3358
191 Ga0466727_329062 3300042655 Bacteria 1970
192 JGI24698J34947_10000145 3300002449 Bacteria 26759
193 JGI24698J34947_10055260 3300002449 Bacteria 1979
194 JGI24695J34938_10000018 3300002450 Bacteria 115524
195 JGI24695J34938_10002264 3300002450 Bacteria 14888
196 JGI24695J34938_10015246 3300002450 Bacteria 3949
197 Ga0072940_1002371 3300005200 Bacteria 16555
198 Ga0072941_1007329 3300005201 Bacteria 2446
199 Ga0072941_1036741 3300005201 Bacteria 4129
200 Ga0466732_156691 3300042656 Unclassified 4618
201 Ga0466733_172664 3300042659 Unclassified 1905
202 Ga0264413_123074 3300024493 Bacteria 2169
203 Ga0466693_041234 3300042592 Bacteria 1250
204 Ga0466691_097129 3300042593 Bacteria 17978
205 Ga0466694_011128 3300042594 Bacteria 1845
206 Ga0466694_041260 3300042594 Unclassified 4998
207 Ga0466696_361650 3300042596 Unclassified 3017
208 Ga0123356_10788459 3300010049 Bacteria 1121
209 Ga0466722_228701 3300042609 Bacteria 35562
210 Ga0466712_067405 3300042614 Bacteria 1739
211 Ga0466712_154605 3300042614 Bacteria 11577
212 Ga0466712_228681 3300042614 Bacteria 33247
213 Ga0466718_032090 3300042617 Bacteria 1204
214 Ga0466726_340797 3300042619 Bacteria 2954
215 Ga0466703_091782 3300042636 Bacteria 4510
216 Ga0466703_257621 3300042636 Bacteria 6544
217 Ga0466704_242754 3300042643 Unclassified 19804
218 Ga0466709_258825 3300042648 Bacteria 56335
219 JGI24698J34947_10001704 3300002449 Unclassified 11730
220 JGI24698J34947_10011853 3300002449 Unclassified 4787
221 JGI24698J34947_10047262 3300002449 Bacteria 2186
222 JGI24695J34938_10037450 3300002450 Bacteria 2203
223 Ga0072940_1070565 3300005200 Unclassified 1685
224 Ga0072941_1162749 3300005201 Bacteria 1229
225 Ga0415639_009184 3300038395 Bacteria 2455
226 Ga0466690_408697 3300042590 Unclassified 5632
227 Ga0466692_115840 3300042591 Bacteria 14463
228 Ga0466699_194186 3300042597 Bacteria 6794
229 Ga0466699_237531 3300042597 Bacteria 77856
230 Ga0466699_249873 3300042597 Bacteria 3150
231 Ga0466699_300613 3300042597 Bacteria 1527
232 Ga0123356_10001821 3300010049 Bacteria 23167
233 Ga0123356_10237499 3300010049 Bacteria 1891
234 Ga0466706_243781 3300042599 Bacteria 1250
235 Ga0466707_164318 3300042601 Bacteria 1554
236 Ga0466716_141629 3300042605 Unclassified 6913
237 Ga0466712_054107 3300042614 Bacteria 23105
238 Ga0466712_287776 3300042614 Bacteria 17058
239 Ga0466712_314425 3300042614 Bacteria 25648
240 Ga0466711_141965 3300042615 Bacteria 4565
241 Ga0466718_018385 3300042617 Bacteria 8383
242 Ga0466726_217492 3300042619 Bacteria 1950
243 Ga0466728_075237 3300042620 Bacteria 16294
244 Ga0466731_026317 3300042622 Bacteria 1905
245 Ga0466731_078248 3300042622 Bacteria 2127
246 Ga0466704_153932 3300042643 Bacteria 8556
247 Ga0466704_192153 3300042643 Bacteria 18083
248 Ga0466709_090526 3300042648 Bacteria 8846
249 2230954280 2228664003 Bacteria 4233
250 JGI24695J34938_10000034 3300002450 Bacteria 102252
251 JGI24695J34938_10000090 3300002450 Bacteria 79670
252 JGI24695J34938_10000490 3300002450 Bacteria 38381
253 JGI24695J34938_10001054 3300002450 Bacteria 24995
254 JGI24695J34938_10002408 3300002450 Bacteria 14365
255 JGI24695J34938_10004156 3300002450 Unclassified 9632

🧩 MSA Aligner

πŸ”¬ Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF22692 LlgE_F_G_D1 Flagellar hook protein FlgE/F/G D1 domain 108 173 0.97
PF00460 Flg_bb_rod Flagella basal body rod protein 19 47 0.96
PF06429 Flg_bbr_C Flagellar basal body rod FlgEFG protein C-terminal 231 274 0.96

πŸ—ΊοΈ Geographic Distribution

Some samples may be missing due to lack of coordinate data.