Protein Family IF10634

Metagenome Isolate
206 Members
120 Samples
152 Scaffolds
233.5 Avg Length

🧬 Representative Sequence

ID
3300056857|Ga0562376_0505|Ga0562376_0505_26730_27575
Length
281 aa
Sequence
MRPVSARSSTVTARPCPSKRPPSTTSAEAEGPTVCIPPTDDRRIIVTIDQRVRALITDTRERVSELHAQLPFWGLVVWTAGNVSERVVVDPSGSPGDEDLLVIKPSGVRYDELSGDMMVVCDLEGNLVEELSTGGLTPSSDTAAHAYVYRNMPQVGGVVHTHSTYATAWAARGEEIPCVLTMMADEFGGPVPVGPFAIIGDDSIGRGIVETLSDSRSPAVLMRNHGPFTIGATGAEAVKAAVMVEEVAKTVHVSRQLGEPLPIEAATIDRLYDRYQNVYGQ

📊 Sample Types

Isolate 26.2%
Metagenome 73.8%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Unclassified 27.3%
Termitidae 20.0%
Kalotermitidae 10.0%
Culicidae 8.2%
Tenebrionidae 7.3%
Armadillidiidae 5.5%
Formicidae 4.5%
Apidae 3.6%
Scarabaeidae 3.6%
Hydrophilidae 1.8%
Curculionidae 1.8%
Cerambycidae 1.8%
Rhinotermitidae 0.9%
Thomisidae 0.9%
Hodotermitidae 0.9%
Pyralidae 0.9%
Termopsidae 0.9%

🌳 Taxonomy

Archaea 0
Bacteria 190
Eukaryota 0
Viruses 0
Unclassified 16

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2820914081 Unclassified Actinobacteria Emb289P3bin87 Isolate Unclassified
2 2865983822 Bifidobacterium xylocopae XV2 Isolate Apidae
3 2597490239 Bifidobacterium bohemicum DSM 22767 Isolate Unclassified
4 2681812870 Oerskovia enterophila DFA-19 Isolate Unclassified
5 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
6 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
7 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
8 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
9 648276708 Pantoea sp. aB Isolate Unclassified
10 8067987626 Agromyces larvae CFWR-12 Isolate Unclassified
11 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
12 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
13 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
14 2820814774 Unclassified Actinobacteria Nt197P3bin39 Isolate Unclassified
15 2820944107 Unclassified Actinobacteria Cu122P5bin14 Isolate Unclassified
16 2856882415 Pseudonocardia sp. Ae406_Ps2 Isolate Formicidae
17 2873558832 Propioniciclava coleopterorum HDW11 Isolate Hydrophilidae
18 2884613238 Agromyces intestinalis KACC 19306 Isolate Scarabaeidae
19 2504756063 Isoptericola variabilis J5 Isolate Unclassified
20 2630969010 Friedmanniella luteola DSM 21741 Isolate Thomisidae
21 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
22 3300056564 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS_oats (Improved Draft) Metagenome Tenebrionidae
23 3300056814 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE (version 2) Metagenome Tenebrionidae
24 3300056857 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS (version 2) Metagenome Tenebrionidae
25 3300057007 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP_oats (version 2) Metagenome Tenebrionidae
26 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
27 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
28 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
29 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
30 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
31 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
32 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
33 3300012839 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG Metagenome Culicidae
34 2820807258 Unclassified Actinobacteria Nt197P3bin90 Isolate Unclassified
35 2820818506 Unclassified Actinobacteria Nt197P3bin3 Isolate Unclassified
36 2820845766 Unclassified Actinobacteria Lab288P3bin96 Isolate Unclassified
37 2820922474 Unclassified Actinobacteria Emb289P3bin154 Isolate Unclassified
38 2824199081 Bifidobacterium commune DSM 28792 Isolate Unclassified
39 2837204985 Lysinimonas sp. 2DFWR-13 Isolate Scarabaeidae
40 2865982043 Bifidobacterium aemilianum XV10 Isolate Apidae
41 2873586004 Sanguibacter sp. HDW7 Isolate Hydrophilidae
42 2505679068 Isoptericola variabilis 225 Isolate Unclassified
43 2645727657 Bifidobacterium actinocoloniiforme DSM 22766 Isolate Unclassified
44 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
45 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
46 8102982778 Erwinia sp. S63 Isolate Curculionidae
47 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
48 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
49 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
50 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
51 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
52 3300012834 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E6 MG Metagenome
53 3300012857 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E0 MG Metagenome Culicidae
54 2847305884 Microbacterium protaetiae DFW100M-13 Isolate Scarabaeidae
55 2856960404 Pseudonocardia sp. Ae706_Ps2 Isolate Formicidae
56 2856973192 Pseudonocardia sp. Ae331_Ps2 Isolate Formicidae
57 2859970369 Pseudonocardia sp. Ae717_Ps2 Isolate Formicidae
58 2931430189 Tessaracoccus palaemonis J1M15 Isolate
59 2084038013 Anoplophora glabripennis gut microbial communities from Worchester, Massachusetts, USA - Larvae Metagenome Cerambycidae
60 2772190761 Rhodococcus rhodnii NRRL B-16535 Isolate Unclassified
61 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
62 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
63 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
64 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
65 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
66 3300012824 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E11 MG Metagenome Armadillidiidae
67 3300012831 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E6 MG Metagenome Culicidae
68 3300012835 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E1 MG Metagenome Culicidae
69 3300012837 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E6 MG Metagenome Armadillidiidae
70 3300012849 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG Metagenome Culicidae
71 3300012850 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E0 MG Metagenome Culicidae
72 3300012854 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E1 MG Metagenome Culicidae
73 2820809073 Unclassified Actinobacteria Nt197P3bin55 Isolate Unclassified
74 2856954254 Pseudonocardia sp. Ae505_Ps2 Isolate Formicidae
75 2884351759 Cellulosimicrobium sp. BI34T Isolate Pyralidae
76 2900368070 Nocardia aurantia RB56 Isolate Termitidae
77 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
78 3300012806 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E1 MG Metagenome
79 3300012809 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E11 MG Metagenome
80 3300012858 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG Metagenome Armadillidiidae
81 2820820509 Unclassified Actinobacteria Nt197P3bin23 Isolate Unclassified
82 2820897376 Unclassified Actinobacteria Lab288P1bin101 Isolate Unclassified
83 2619619082 Pantoea agglomerans SL1_M5 Isolate Unclassified
84 3300056790 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) Metagenome Tenebrionidae
85 3300056856 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) Metagenome Tenebrionidae
86 8030347546 Propionimicrobium sp. PCR01-08-3 Isolate Tenebrionidae
87 8069511479 Arthrobacter ipsi IA7 Isolate Curculionidae
88 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
89 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
90 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
91 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
92 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
93 3300012841 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E1 MG Metagenome Armadillidiidae
94 3300012852 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E0 MG Metagenome
95 2820857933 Unclassified Actinobacteria Lab288P3bin173 Isolate Unclassified
96 2861945162 Microbacterium sp. AR7-10 Isolate Culicidae
97 2600255079 Bifidobacterium bombi DSM 19703 Isolate Apidae
98 2731957681 Xylanimicrobium pachnodae JCM 13526, NBRC 107786 Isolate Scarabaeidae
99 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
100 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
101 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
102 3002678670 Agromyces sp. G127AT Isolate Unclassified
103 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
104 3300012798 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E6 MG Metagenome
105 3300012805 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E11 MG Metagenome
106 3300012814 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E6 MG Metagenome
107 3300012815 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E1 MG Metagenome
108 2820825283 Unclassified Actinobacteria Nt197P3bin111 Isolate Unclassified
109 2820829137 Unclassified Actinobacteria Nc150P5bin2 Isolate Unclassified
110 2820894511 Unclassified Actinobacteria Lab288P1bin103 Isolate Unclassified
111 2883361506 Luteimicrobium xylanilyticum HY-24 Isolate Cerambycidae
112 2918394494 Microbacterium imperiale DSM 20530 Isolate Unclassified
113 2788500098 Bombiscardovia coagulans DSM 22924 Isolate Apidae
114 2816332114 Microbacterium saperdae DSM 20169 Isolate Unclassified
115 3300056842 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) Metagenome Tenebrionidae
116 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
117 3300012820 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E6 MG Metagenome Armadillidiidae
118 3300012825 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E1 MG Metagenome
119 3300012848 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG Metagenome Armadillidiidae
120 3300012861 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E0 MG Metagenome Culicidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_139101 3300042612 Bacteria 7419
2 Ga0530661_001163 3300056564 Bacteria 14569
3 Ga0562377_0204 3300056842 Bacteria 154479
4 Ga0466707_295929 3300042601 Bacteria 1180
5 Ga0466707_366045 3300042601 Bacteria 3592
6 Ga0466713_058184 3300042602 Bacteria 2357
7 Ga0466713_061580 3300042602 Bacteria 1185
8 Ga0466716_543051 3300042605 Bacteria 8749
9 Ga0160453_103700 3300012814 Bacteria 3063
10 Ga0160440_100038 3300012815 Bacteria 193167
11 Ga0160441_100412 3300012825 Bacteria 35339
12 Ga0160452_100013 3300012834 Bacteria 343612
13 Ga0160452_106449 3300012834 Bacteria 1624
14 Ga0160434_101211 3300012850 Unclassified 5045
15 Ga0160435_1003264 3300012857 Unclassified 3854
16 Ga0160457_1000048 3300012858 Bacteria 195641
17 Ga0123357_10215508 3300009784 Bacteria 2144
18 Ga0123357_10331201 3300009784 Bacteria 1487
19 Ga0123354_10001795 3300010882 Bacteria 27049
20 Ga0123354_10221876 3300010882 Bacteria 2005
21 AustNasuHG_c1010800 3300000089 Bacteria 3173
22 Ga0072940_1032841 3300005200 Bacteria 1031
23 Ga0466724_10428 3300042649 Bacteria 343216
24 Ga0466723_010712 3300042618 Bacteria 5968
25 Ga0562379_0068 3300056790 Unclassified 438584
26 Ga0562379_1758 3300056790 Unclassified 22193
27 Ga0562378_2242 3300056814 Bacteria 16862
28 Ga0562376_0551 3300056857 Bacteria 65914
29 Ga0562374_0278 3300057007 Bacteria 99329
30 Ga0466720_208637 3300042607 Bacteria 1676
31 Ga0160456_102227 3300012820 Bacteria 3770
32 Ga0160434_102253 3300012850 Bacteria 3366
33 Ga0160430_104045 3300012852 Bacteria 3790
34 Ga0415639_208391 3300038395 Bacteria 2148
35 Ga0466693_121857 3300042592 Bacteria 33009
36 Ga0123357_10006231 3300009784 Bacteria 14490
37 Ga0123356_10267255 3300010049 Bacteria 1798
38 Ga0466704_210731 3300042643 Bacteria 8276
39 Ga0466715_531886 3300042616 Bacteria 37554
40 Ga0466705_205467 3300042612 Bacteria 4365
41 Ga0562375_2757 3300056856 Unclassified 18631
42 Ga0562375_6174 3300056856 Bacteria 5584
43 Ga0562376_1976 3300056857 Unclassified 26569
44 Ga0562374_1671 3300057007 Unclassified 24638
45 Ga0466700_141056 3300042600 Bacteria 5366
46 Ga0466714_024759 3300042603 Bacteria 6403
47 Ga0160441_100253 3300012825 Unclassified 52094
48 Ga0160459_101987 3300012831 Bacteria 3662
49 Ga0160447_101630 3300012849 Bacteria 8551
50 Ga0466696_374158 3300042596 Bacteria 2013
51 Ga0123357_10000211 3300009784 Bacteria 54763
52 Ga0562379_0280 3300056790 Bacteria 130842
53 Ga0562378_0455 3300056814 Unclassified 70604
54 Ga0562376_0265 3300056857 Unclassified 105056
55 Ga0562374_0248 3300057007 Bacteria 108733
56 Ga0562374_0415 3300057007 Bacteria 75571
57 Ga0466713_143380 3300042602 Bacteria 10621
58 Ga0466717_171292 3300042604 Unclassified 1158
59 Ga0466717_216905 3300042604 Bacteria 1005
60 Ga0466697_019988 3300042611 Bacteria 20243
61 Ga0160444_103743 3300012841 Bacteria 2135
62 Ga0160430_100221 3300012852 Bacteria 41444
63 Ga0160448_108436 3300012854 Bacteria 2357
64 Ga0160457_1006126 3300012858 Bacteria 1797
65 Ga0160436_1006137 3300012861 Unclassified 2801
66 Ga0466691_056195 3300042593 Bacteria 4112
67 Ga0123355_10322777 3300009826 Unclassified 2078
68 Ga0123353_10003322 3300010167 Bacteria 20296
69 Ga0160454_100020 3300012798 Bacteria 314645
70 Ga0068305_10163251 3300005083 Bacteria 1845
71 Ga0072940_1158016 3300005200 Bacteria 1279
72 Ga0466730_058197 3300042625 Bacteria 1248
73 Ga0466703_026338 3300042636 Bacteria 53423
74 Ga0466727_269894 3300042655 Bacteria 1178
75 Ga0466718_036776 3300042617 Bacteria 5483
76 Ga0562379_0056 3300056790 Bacteria 479351
77 Ga0562378_0009 3300056814 Bacteria 1179729
78 Ga0466707_157302 3300042601 Bacteria 1145
79 Ga0466713_042107 3300042602 Bacteria 17325
80 Ga0466713_112973 3300042602 Bacteria 1417
81 Ga0466714_063291 3300042603 Bacteria 4762
82 Ga0160446_100041 3300012835 Bacteria 137551
83 Ga0123356_10897180 3300010049 Bacteria 1058
84 Ga0123354_10256127 3300010882 Bacteria 1760
85 Ga0160464_100094 3300012805 Bacteria 101996
86 Ga0160466_104653 3300012809 Bacteria 1945
87 Ga0123357_10000738 3300009784 Bacteria 32853
88 Ga0466731_236044 3300042622 Bacteria 1156
89 Ga0466730_083135 3300042625 Bacteria 3390
90 Ga0466704_393730 3300042643 Bacteria 8542
91 Ga0466727_055996 3300042655 Bacteria 8529
92 Ga0466705_492506 3300042612 Bacteria 3662
93 Ga0466711_157875 3300042615 Bacteria 2768
94 Ga0466723_131311 3300042618 Bacteria 54026
95 Ga0466729_005104 3300042621 Bacteria 7657
96 Ga0562377_1739 3300056842 Bacteria 20305
97 Ga0562376_0505 3300056857 Bacteria 69929
98 Ga0562374_0069 3300057007 Bacteria 334102
99 Ga0466713_110517 3300042602 Bacteria 51188
100 Ga0466713_152046 3300042602 Unclassified 2468
101 Ga0160469_101889 3300012824 Bacteria 4685
102 Ga0160435_1001688 3300012857 Bacteria 5535
103 Ga0160457_1007029 3300012858 Bacteria 1655
104 Ga0466657_161494 3300042582 Bacteria 3265
105 Ga0466693_213801 3300042592 Bacteria 4231
106 Ga0466691_135440 3300042593 Bacteria 6229
107 Ga0466696_049801 3300042596 Bacteria 5161
108 Ga0123357_10085188 3300009784 Bacteria 4138
109 Ga0123357_10105709 3300009784 Bacteria 3611
110 Ga0123356_10433156 3300010049 Bacteria 1460
111 Ga0123354_10009942 3300010882 Bacteria 14621
112 AustNasuHG_c1000396 3300000089 Bacteria 15166
113 Ga0068305_10163250 3300005083 Bacteria 912
114 Ga0123357_10001375 3300009784 Bacteria 25747
115 Ga0466704_005591 3300042643 Bacteria 4792
116 Ga0466705_488651 3300042612 Bacteria 2299
117 Ga0466723_209795 3300042618 Bacteria 2026
118 Ga0562375_0293 3300056856 Bacteria 126554
119 Ga0466713_079439 3300042602 Bacteria 20377
120 Ga0466719_156423 3300042606 Bacteria 6411
121 Ga0160448_100001 3300012854 Bacteria 878844
122 Ga0160457_1004456 3300012858 Bacteria 2241
123 Ga0123356_10006147 3300010049 Bacteria 12176
124 Ga0123353_10478440 3300010167 Bacteria 1823
125 Ga0160442_100300 3300012806 Bacteria 27660
126 AglaG_contig22684 2084038013 Bacteria 1549
127 Ga0466704_266161 3300042643 Bacteria 1419
128 Ga0466704_325446 3300042643 Bacteria 2264
129 Ga0466723_157554 3300042618 Bacteria 8809
130 Ga0466723_262363 3300042618 Bacteria 3053
131 Ga0466728_204775 3300042620 Bacteria 1000
132 Ga0466733_204026 3300042659 Bacteria 3185
133 Ga0562375_3200 3300056856 Unclassified 16072
134 Ga0466706_155092 3300042599 Bacteria 2729
135 Ga0466713_030768 3300042602 Bacteria 254028
136 Ga0160456_104607 3300012820 Bacteria 1783
137 Ga0160469_103928 3300012824 Bacteria 1869
138 Ga0160455_102185 3300012837 Bacteria 4382
139 Ga0160472_100002 3300012839 Bacteria 878838
140 Ga0160443_100119 3300012848 Bacteria 125007
141 Ga0160447_103341 3300012849 Bacteria 5171
142 Ga0160436_1000222 3300012861 Bacteria 27741
143 Ga0466657_172348 3300042582 Bacteria 10849
144 Ga0466696_336114 3300042596 Bacteria 2652
145 Ga0123356_10001060 3300010049 Bacteria 30467
146 Ga0123356_10016708 3300010049 Bacteria 6997
147 Ga0123353_10185898 3300010167 Unclassified 3286
148 Ga0123354_10067471 3300010882 Bacteria 5210
149 Ga0123354_10337948 3300010882 Bacteria 1362
150 AustNasuHG_c1024302 3300000089 Bacteria 1921
151 JGI24705J35276_12227529 3300002504 Bacteria 3019
152 Ga0466728_262451 3300042620 Bacteria 2108

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00596 Aldolase_II Class II Aldolase and Adducin N-terminal domain 62 250 0.92

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.