Protein Family IF10353

Metagenome Isolate
151 Members
57 Samples
131 Scaffolds
410.85 Avg Length

🧬 Representative Sequence

ID
3300042659|Ga0466733_186141|Ga0466733_186141_323_1606
Length
416 aa
Sequence
MDFSEFNFHPTVMEGLDAMRFQTATPVQELTIPIIMQGRDIVACAQTGTGKTAAYLLPILHKLCETPHPQDSINAIVIAPTRELAQQIDQQLEGFSYFMPVSSVAVYGGNDGGAWDQQKRGLEKGADFVIATPGRLLSHLNINSNIDFSRVQYFILDEADRMLDMGFFDDIMQVVKRLGKNRQTILFSATMPDKIRQLANAILQDPEEVKIAVSKPAEGIKQSAFICHEGQKQGIIQSLFSEHQPDRAIIFVGSKMKVKEVAAGLRKFCKGVAEMHSDLEQAQREETMNGFRSGRIKLLVATDVVSRGIDVEDIELVINYDVPRAAEDYVHRIGRTARASAEGAAITLVSDKDQPTFKRIEDFLEKEIEKSPVPENLGKAPEYNPAKFVGRFGDKKGQRSGGQHRHKKPVANKKAE

📊 Sample Types

Isolate 13.2%
Metagenome 86.8%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Blattidae 35.7%
Kalotermitidae 25.0%
Termitidae 16.1%
Rhinotermitidae 5.4%
Passalidae 5.4%
Unclassified 5.4%
Termopsidae 3.6%
Hodotermitidae 1.8%
Culicidae 1.8%

🌳 Taxonomy

Archaea 0
Bacteria 150
Eukaryota 0
Viruses 0
Unclassified 1

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2940199050 Parabacteroides sp. PM6-13 Isolate Blattidae
2 2940202316 Parabacteroides sp. PF5-9 Isolate Blattidae
3 2940371297 Parabacteroides sp. PM5-20 Isolate Blattidae
4 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
5 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
6 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
7 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
8 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
9 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
10 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
11 2940195863 Parabacteroides sp. PF5-6 Isolate Blattidae
12 2940298504 Parabacteroides sp. PF5-13 Isolate Blattidae
13 3004667792 Bacteroides sp. 519 Isolate Blattidae
14 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
15 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
16 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
17 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
18 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
19 2923982719 Parabacteroides sp. 52 Isolate Blattidae
20 2940306115 Parabacteroides sp. PFB2-22 Isolate Blattidae
21 2940309933 Parabacteroides sp. PH5-13 Isolate Blattidae
22 2940328985 Parabacteroides sp. PH5-46 Isolate Blattidae
23 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
24 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
25 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
26 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
27 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
28 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
29 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
30 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
31 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
32 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
33 2940205530 Parabacteroides sp. PH5-33 Isolate Blattidae
34 2940317558 Parabacteroides sp. PH5-26 Isolate Blattidae
35 2940325180 Parabacteroides sp. PH5-41 Isolate Blattidae
36 2922326829 Bacteroides sp. 224 Isolate Blattidae
37 2940313741 Parabacteroides sp. PH5-17 Isolate Blattidae
38 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
39 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
40 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
41 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
42 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
43 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
44 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
45 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
46 2940346213 Parabacteroides sp. PFB2-12 Isolate Blattidae
47 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
48 2225789003 Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) Metagenome Passalidae
49 2940212447 Parabacteroides sp. PH5-16 Isolate Blattidae
50 2940302308 Parabacteroides sp. PF5-5 Isolate Blattidae
51 2940321370 Parabacteroides sp. PH5-39 Isolate Blattidae
52 2940332795 Parabacteroides sp. PH5-8 Isolate Blattidae
53 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
54 3300012813 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E11 MG Metagenome Culicidae
55 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
56 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
57 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466703_342364 3300042636 Bacteria 6891
2 Ga0466709_334966 3300042648 Bacteria 3081
3 Ga0466727_051963 3300042655 Bacteria 6857
4 Ga0466696_248480 3300042596 Bacteria 8299
5 Ga0466728_261552 3300042620 Bacteria 4625
6 IMNBL1DRAFT_c0002159 3300000062 Bacteria 13932
7 Ga0072941_1405744 3300005201 Bacteria 1516
8 Ga0466706_047399 3300042599 Bacteria 1788
9 Ga0466706_098228 3300042599 Bacteria 39742
10 Ga0466722_051355 3300042609 Bacteria 31148
11 Ga0466703_120191 3300042636 Bacteria 3068
12 Ga0466704_471365 3300042643 Bacteria 37639
13 Ga0466704_472879 3300042643 Bacteria 13574
14 Ga0466690_106639 3300042590 Bacteria 6486
15 Ga0466692_042425 3300042591 Bacteria 36466
16 Ga0466691_031003 3300042593 Bacteria 14168
17 Ga0466715_007714 3300042616 Bacteria 20281
18 Ga0466715_037900 3300042616 Bacteria 143938
19 Ga0466715_613585 3300042616 Bacteria 24795
20 Ga0466728_371959 3300042620 Bacteria 5889
21 2227610723 2225789004 Bacteria 12124
22 IMNBL1DRAFT_c0001129 3300000062 Bacteria 20460
23 JGI24702J35022_10014451 3300002462 Bacteria 4356
24 JGI24696J40584_12961293 3300002834 Bacteria 13128
25 Ga0466706_135756 3300042599 Bacteria 21184
26 Ga0466706_286866 3300042599 Bacteria 2075
27 Ga0466719_401362 3300042606 Bacteria 6480
28 Ga0466722_146807 3300042609 Bacteria 6613
29 Ga0466705_012645 3300042612 Bacteria 7552
30 Ga0466733_162634 3300042659 Bacteria 12785
31 Ga0466733_186141 3300042659 Bacteria 8487
32 Ga0466703_019316 3300042636 Bacteria 19998
33 Ga0466703_070668 3300042636 Bacteria 9689
34 Ga0466709_215893 3300042648 Bacteria 4855
35 Ga0466725_012412 3300042654 Bacteria 26917
36 Ga0466727_079271 3300042655 Bacteria 1953
37 Ga0466692_147996 3300042591 Bacteria 7875
38 Ga0466693_439199 3300042592 Bacteria 2219
39 Ga0466696_278891 3300042596 Bacteria 171866
40 Ga0466711_042337 3300042615 Bacteria 11612
41 Ga0466711_109380 3300042615 Bacteria 31839
42 Ga0466715_083734 3300042616 Bacteria 4289
43 Ga0466715_353013 3300042616 Bacteria 8109
44 Ga0466726_359970 3300042619 Bacteria 3535
45 JGI24702J35022_10002179 3300002462 Bacteria 12067
46 JGI24702J35022_10003838 3300002462 Bacteria 9020
47 Ga0466706_031709 3300042599 Bacteria 16740
48 Ga0466707_382222 3300042601 Bacteria 7072
49 Ga0466713_003255 3300042602 Bacteria 2306
50 Ga0466713_108254 3300042602 Bacteria 1769
51 Ga0466705_068471 3300042612 Bacteria 9310
52 Ga0466703_258576 3300042636 Bacteria 1959
53 Ga0466704_063568 3300042643 Bacteria 7323
54 Ga0466727_203052 3300042655 Bacteria 14252
55 Ga0466690_249215 3300042590 Bacteria 8764
56 Ga0466690_253817 3300042590 Bacteria 10765
57 Ga0466715_567151 3300042616 Bacteria 35252
58 Ga0123353_10573030 3300010167 Bacteria 1622
59 JGI24702J35022_10037247 3300002462 Bacteria 2598
60 Ga0466706_174110 3300042599 Bacteria 65436
61 Ga0466713_020992 3300042602 Bacteria 62959
62 Ga0466713_041582 3300042602 Bacteria 35087
63 Ga0466716_160457 3300042605 Bacteria 8760
64 Ga0466716_432952 3300042605 Bacteria 18137
65 Ga0466722_240768 3300042609 Bacteria 19386
66 Ga0466705_288409 3300042612 Bacteria 9614
67 Ga0466733_202578 3300042659 Bacteria 7510
68 Ga0466703_157676 3300042636 Bacteria 5897
69 Ga0466704_374004 3300042643 Bacteria 15901
70 Ga0466727_207370 3300042655 Bacteria 4735
71 Ga0466690_325412 3300042590 Bacteria 27630
72 Ga0466694_184032 3300042594 Bacteria 1628
73 Ga0466696_063686 3300042596 Bacteria 6628
74 Ga0466723_195534 3300042618 Bacteria 4998
75 Ga0123356_10099350 3300010049 Bacteria 2789
76 Ga0466707_336776 3300042601 Bacteria 6667
77 Ga0466713_149568 3300042602 Bacteria 40583
78 Ga0466714_013813 3300042603 Bacteria 151010
79 Ga0466719_151669 3300042606 Bacteria 4151
80 Ga0466722_090500 3300042609 Bacteria 8166
81 Ga0466705_031444 3300042612 Bacteria 4054
82 Ga0466704_199203 3300042643 Bacteria 10322
83 Ga0466708_086991 3300042652 Bacteria 84818
84 Ga0466727_061283 3300042655 Bacteria 22990
85 Ga0466696_168764 3300042596 Bacteria 12119
86 Ga0466711_123903 3300042615 Bacteria 10875
87 Ga0466711_226745 3300042615 Bacteria 1694
88 JGI24702J35022_10000131 3300002462 Bacteria 37210
89 Ga0466706_193517 3300042599 Bacteria 13890
90 Ga0466716_467224 3300042605 Bacteria 5000
91 Ga0466722_059240 3300042609 Bacteria 3293
92 Ga0466722_252060 3300042609 Bacteria 10534
93 Ga0466705_116524 3300042612 Bacteria 1530
94 Ga0466733_025416 3300042659 Bacteria 189255
95 Ga0466703_384196 3300042636 Bacteria 5798
96 Ga0466704_513594 3300042643 Unclassified 3029
97 Ga0466690_264520 3300042590 Bacteria 31137
98 Ga0466691_065526 3300042593 Bacteria 12371
99 Ga0466696_227170 3300042596 Bacteria 9389
100 Ga0466705_460664 3300042612 Bacteria 19970
101 Ga0466711_008567 3300042615 Bacteria 15554
102 Ga0466711_073380 3300042615 Bacteria 11163
103 Ga0466728_071660 3300042620 Bacteria 25955
104 Ga0160470_100005 3300012813 Bacteria 615500
105 2226980371 2225789003 Bacteria 33112
106 IMNBL1DRAFT_c0002283 3300000062 Bacteria 13508
107 Ga0068305_10020657 3300005083 Bacteria 24279
108 Ga0068305_10021548 3300005083 Bacteria 32392
109 Ga0466716_026310 3300042605 Bacteria 16932
110 Ga0466716_318424 3300042605 Bacteria 12350
111 Ga0466719_145993 3300042606 Bacteria 3605
112 Ga0466703_022505 3300042636 Bacteria 6301
113 Ga0466704_082193 3300042643 Bacteria 8478
114 Ga0466704_137469 3300042643 Bacteria 3598
115 Ga0466704_196953 3300042643 Bacteria 20194
116 Ga0466708_013865 3300042652 Bacteria 14920
117 Ga0466708_117511 3300042652 Bacteria 28515
118 Ga0466727_164396 3300042655 Bacteria 6455
119 Ga0466690_362030 3300042590 Bacteria 3859
120 Ga0466691_029267 3300042593 Bacteria 26342
121 Ga0466696_044701 3300042596 Bacteria 6094
122 Ga0466711_117551 3300042615 Bacteria 11311
123 Ga0466723_095121 3300042618 Bacteria 177949
124 Ga0466723_182664 3300042618 Bacteria 13551
125 Ga0466729_123526 3300042621 Bacteria 33019
126 Ga0123356_10240233 3300010049 Bacteria 1882
127 IMNBL1DRAFT_c0000274 3300000062 Bacteria 45532
128 Ga0466706_074381 3300042599 Bacteria 5346
129 Ga0466706_273282 3300042599 Bacteria 15137
130 Ga0466707_048942 3300042601 Bacteria 15157
131 Ga0466707_087813 3300042601 Bacteria 8092

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00271 Helicase_C Helicase conserved C-terminal domain 234 339 0.91
PF00270 DEAD DEAD/DEAH box helicase 25 197 0.9
PF04851 ResIII Type III restriction enzyme, res subunit 38 192 0.78

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.