Protein Family IF10287
Metagenome
Isolate
121
Members
49
Samples
118
Scaffolds
407.45
Avg Length
Representative Sequence
- ID
- 3300042659|Ga0466733_043686|Ga0466733_043686_2526_3761
- Length
- 403 aa
- Sequence
- MYQVIRNEKYDFIGQSYATVYPNLHKYPATMLPQIGIEIFKELDIKSGKLLDPYCGSGSSFASGLESGLTEMHGFDINPLAVLISKVRFTRVSVNRIIEIKSELRNNIYEFLKDEQNIETLNQPQITNINFWFSKEVIDSLTIIKYFIEQIQDENIRRFFLIPFSETVRECSYTRNNEFKLFRMKSEDLLCFNPDVIGVYLKKLEDTIFLYSNFYFPKLNEKYSTFQPKDEYFDVVLTSPPYGDSRTTVAYGQFSTLSNEWLGIDYARKIDGMLMGGVKPKQNIQNGIIADYISEINKVDNKRALEVSAFYNDLDSSIRQVARSICKGGKSIYVVGNRTVKNIQLPTDQFVAEKFEQNGFRHLTTYKRALNNKSMPSKNSPTNKTGKTVNTMLWEYIVICEKN
Sample Types
Isolate
2.5%
Metagenome
97.5%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
46.9%
Kalotermitidae
26.5%
Unclassified
10.2%
Rhinotermitidae
6.1%
Termopsidae
6.1%
Passalidae
4.1%
Taxonomy
Archaea
2
Bacteria
100
Eukaryota
0
Viruses
0
Unclassified
19
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 2 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 3 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 4 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 5 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 6 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 7 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 8 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 9 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 10 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 11 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 12 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 13 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 14 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 15 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 16 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 17 | 2820783511 | Unclassified Bacteroidetes Emb289P3bin108 | Isolate | Unclassified |
| 18 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 19 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 20 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 21 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 22 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 23 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 24 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 25 | 2820724199 | Unclassified Cloacimonetes Th196P3bin22 | Isolate | Unclassified |
| 26 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 27 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 28 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 29 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 30 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 31 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 32 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 33 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 34 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 35 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 36 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 37 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 38 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 39 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 40 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 41 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 42 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 43 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 44 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 45 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 46 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 47 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 48 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 49 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0123353_10318289 | 3300010167 | Bacteria | 2363 |
| 2 | Ga0466705_490885 | 3300042612 | Unclassified | 18364 |
| 3 | Ga0466712_029166 | 3300042614 | Bacteria | 6217 |
| 4 | Ga0466711_189776 | 3300042615 | Bacteria | 3053 |
| 5 | Ga0466711_303433 | 3300042615 | Bacteria | 5745 |
| 6 | Ga0466723_114391 | 3300042618 | Unclassified | 9483 |
| 7 | JGI24702J35022_10046243 | 3300002462 | Bacteria | 2318 |
| 8 | JGI24699J35502_11002165 | 3300002509 | Bacteria | 1358 |
| 9 | Ga0466708_113813 | 3300042652 | Bacteria | 5322 |
| 10 | Ga0466716_368604 | 3300042605 | Unclassified | 3130 |
| 11 | Ga0466690_025127 | 3300042590 | Bacteria | 8406 |
| 12 | Ga0466693_239208 | 3300042592 | Unclassified | 1579 |
| 13 | Ga0466705_064748 | 3300042612 | Bacteria | 2603 |
| 14 | Ga0466733_043686 | 3300042659 | Bacteria | 5953 |
| 15 | Ga0466705_492630 | 3300042612 | Bacteria | 10498 |
| 16 | Ga0466710_026972 | 3300042613 | Bacteria | 5052 |
| 17 | Ga0466718_057353 | 3300042617 | Unclassified | 12564 |
| 18 | Ga0466718_086014 | 3300042617 | Bacteria | 2003 |
| 19 | Ga0466726_111019 | 3300042619 | Bacteria | 1319 |
| 20 | Ga0466726_423771 | 3300042619 | Bacteria | 1462 |
| 21 | Ga0466726_449330 | 3300042619 | Bacteria | 2220 |
| 22 | Ga0466729_180708 | 3300042621 | Bacteria | 3071 |
| 23 | Ga0466703_281678 | 3300042636 | Bacteria | 4002 |
| 24 | Ga0466704_404243 | 3300042643 | Archaea | 2527 |
| 25 | Ga0466716_529639 | 3300042605 | Unclassified | 28262 |
| 26 | Ga0466722_150690 | 3300042609 | Bacteria | 13163 |
| 27 | Ga0466722_191585 | 3300042609 | Bacteria | 7556 |
| 28 | Ga0466722_250030 | 3300042609 | Bacteria | 3163 |
| 29 | Ga0466690_107479 | 3300042590 | Bacteria | 2752 |
| 30 | Ga0466697_137824 | 3300042611 | Bacteria | 2017 |
| 31 | Ga0123356_10371472 | 3300010049 | Bacteria | 1560 |
| 32 | Ga0123353_10129856 | 3300010167 | Bacteria | 4045 |
| 33 | Ga0466710_139920 | 3300042613 | Bacteria | 3646 |
| 34 | Ga0466712_235528 | 3300042614 | Bacteria | 7080 |
| 35 | Ga0466712_243408 | 3300042614 | Bacteria | 2861 |
| 36 | Ga0466711_058431 | 3300042615 | Bacteria | 3457 |
| 37 | JGI24702J35022_10000550 | 3300002462 | Bacteria | 22684 |
| 38 | JGI24702J35022_10047133 | 3300002462 | Bacteria | 2294 |
| 39 | Ga0466724_24669 | 3300042649 | Bacteria | 4781 |
| 40 | Ga0466716_301694 | 3300042605 | Bacteria | 2186 |
| 41 | Ga0466721_273892 | 3300042608 | Unclassified | 3191 |
| 42 | Ga0466722_029491 | 3300042609 | Bacteria | 9543 |
| 43 | Ga0466656_069580 | 3300042550 | Bacteria | 2217 |
| 44 | Ga0466691_200043 | 3300042593 | Bacteria | 1811 |
| 45 | Ga0466732_175493 | 3300042656 | Bacteria | 64076 |
| 46 | Ga0123356_10098737 | 3300010049 | Unclassified | 2797 |
| 47 | Ga0123356_10321526 | 3300010049 | Bacteria | 1660 |
| 48 | Ga0123354_10055850 | 3300010882 | Bacteria | 5903 |
| 49 | Ga0466723_018544 | 3300042618 | Bacteria | 4962 |
| 50 | Ga0466726_027240 | 3300042619 | Unclassified | 7312 |
| 51 | Ga0466728_420632 | 3300042620 | Bacteria | 1900 |
| 52 | JGI24702J35022_10028375 | 3300002462 | Bacteria | 3008 |
| 53 | Ga0466734_110266 | 3300042623 | Unclassified | 1468 |
| 54 | Ga0466704_096105 | 3300042643 | Bacteria | 6602 |
| 55 | Ga0466704_123555 | 3300042643 | Unclassified | 16126 |
| 56 | Ga0466708_097434 | 3300042652 | Bacteria | 13111 |
| 57 | Ga0466727_087121 | 3300042655 | Bacteria | 3754 |
| 58 | Ga0466707_193359 | 3300042601 | Bacteria | 58762 |
| 59 | Ga0466716_063430 | 3300042605 | Bacteria | 3499 |
| 60 | Ga0466698_301508 | 3300042610 | Bacteria | 4207 |
| 61 | Ga0466692_016435 | 3300042591 | Bacteria | 18396 |
| 62 | Ga0466691_027141 | 3300042593 | Bacteria | 2525 |
| 63 | Ga0466705_040859 | 3300042612 | Bacteria | 1871 |
| 64 | Ga0123353_10340654 | 3300010167 | Bacteria | 2264 |
| 65 | Ga0466711_196623 | 3300042615 | Unclassified | 2835 |
| 66 | IMNBL1DRAFT_c0039319 | 3300000062 | Bacteria | 1616 |
| 67 | Ga0466735_000490 | 3300042624 | Unclassified | 1353 |
| 68 | Ga0466707_059896 | 3300042601 | Bacteria | 59431 |
| 69 | Ga0466716_279674 | 3300042605 | Bacteria | 3471 |
| 70 | Ga0466697_027305 | 3300042611 | Bacteria | 2434 |
| 71 | Ga0466692_176060 | 3300042591 | Bacteria | 6669 |
| 72 | Ga0466694_350366 | 3300042594 | Bacteria | 2044 |
| 73 | Ga0466695_108932 | 3300042595 | Bacteria | 2182 |
| 74 | Ga0466696_137847 | 3300042596 | Unclassified | 9501 |
| 75 | Ga0466699_331545 | 3300042597 | Bacteria | 6978 |
| 76 | Ga0466715_273591 | 3300042616 | Bacteria | 1588 |
| 77 | Ga0466723_131423 | 3300042618 | Bacteria | 3165 |
| 78 | JGI24699J35502_11132900 | 3300002509 | Bacteria | 7906 |
| 79 | Ga0068305_10324573 | 3300005083 | Bacteria | 2015 |
| 80 | Ga0466729_274675 | 3300042621 | Bacteria | 4207 |
| 81 | Ga0466703_422960 | 3300042636 | Bacteria | 7751 |
| 82 | Ga0466704_045319 | 3300042643 | Unclassified | 4241 |
| 83 | Ga0466716_126614 | 3300042605 | Bacteria | 2684 |
| 84 | Ga0466719_056317 | 3300042606 | Bacteria | 5281 |
| 85 | Ga0466719_189155 | 3300042606 | Bacteria | 2449 |
| 86 | Ga0466719_190504 | 3300042606 | Bacteria | 6724 |
| 87 | Ga0466695_279513 | 3300042595 | Unclassified | 1358 |
| 88 | Ga0466697_219637 | 3300042611 | Bacteria | 3325 |
| 89 | Ga0466705_176687 | 3300042612 | Bacteria | 2799 |
| 90 | Ga0466733_108853 | 3300042659 | Bacteria | 1777 |
| 91 | Ga0123356_10108591 | 3300010049 | Bacteria | 2676 |
| 92 | Ga0123353_10134670 | 3300010167 | Archaea | 3963 |
| 93 | Ga0123353_10524646 | 3300010167 | Bacteria | 1717 |
| 94 | Ga0123354_10145887 | 3300010882 | Unclassified | 2897 |
| 95 | Ga0466710_023236 | 3300042613 | Bacteria | 3336 |
| 96 | Ga0466710_308011 | 3300042613 | Bacteria | 1746 |
| 97 | Ga0466723_090526 | 3300042618 | Bacteria | 41461 |
| 98 | Ga0466723_251692 | 3300042618 | Bacteria | 2224 |
| 99 | Ga0466726_431470 | 3300042619 | Bacteria | 6163 |
| 100 | Ga0068305_10354281 | 3300005083 | Unclassified | 2536 |
| 101 | Ga0466714_121075 | 3300042603 | Bacteria | 1365 |
| 102 | Ga0466691_054914 | 3300042593 | Bacteria | 7709 |
| 103 | Ga0466732_444135 | 3300042656 | Bacteria | 5200 |
| 104 | Ga0123357_10222436 | 3300009784 | Bacteria | 2091 |
| 105 | Ga0123356_10080301 | 3300010049 | Bacteria | 3083 |
| 106 | Ga0123354_10036600 | 3300010882 | Bacteria | 7653 |
| 107 | Ga0123354_10074269 | 3300010882 | Bacteria | 4873 |
| 108 | Ga0466715_175132 | 3300042616 | Bacteria | 16269 |
| 109 | 2227541608 | 2225789004 | Bacteria | 2980 |
| 110 | JGI24696J40584_12951223 | 3300002834 | Bacteria | 2221 |
| 111 | Ga0466727_272440 | 3300042655 | Bacteria | 6607 |
| 112 | Ga0466713_068732 | 3300042602 | Bacteria | 2165 |
| 113 | Ga0466716_187846 | 3300042605 | Bacteria | 3976 |
| 114 | Ga0466719_234443 | 3300042606 | Bacteria | 3051 |
| 115 | Ga0466721_219869 | 3300042608 | Bacteria | 2136 |
| 116 | Ga0466722_224938 | 3300042609 | Bacteria | 1882 |
| 117 | Ga0466698_024385 | 3300042610 | Bacteria | 2343 |
| 118 | Ga0466691_146724 | 3300042593 | Unclassified | 6626 |
MSA Aligner
Geographic Distribution
Some samples may be missing due to lack of coordinate data.