Protein Family IF10266
Metagenome
Isolate
141
Members
88
Samples
108
Scaffolds
183.72
Avg Length
Representative Sequence
- ID
- 3300042659|Ga0466733_003157|Ga0466733_003157_5735_6382
- Length
- 215 aa
- Sequence
- MMPISSTSPKLVILDRDGTINEDSDHFVKSPEEWIPLPGALQAIARLSQMGWQVVVATNQSGLGRGLFDIVALNAMHEKMKQLLAVEGGRIEAVFFCPHVASDMCHCRKPLPGLFEQIGERFRADLRDVPAVGDSLRDLQAAAAAGAQPHLVRTGKGQQTALRDDLPAGTVIHEDLSHFVDYWLQQQAQLNDGTDLLEEKLRQDALVASRDQRGV
Sample Types
Isolate
23.4%
Metagenome
76.6%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Unclassified
19.0%
Termitidae
17.9%
Formicidae
16.7%
Coreidae
15.5%
Kalotermitidae
9.5%
Culicidae
8.3%
Rhinotermitidae
3.6%
Elmidae
3.6%
Armadillidiidae
2.4%
Hodotermitidae
1.2%
Berytidae
1.2%
Termopsidae
1.2%
Taxonomy
Archaea
0
Bacteria
129
Eukaryota
0
Viruses
0
Unclassified
12
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820084079 | Unclassified Proteobacteria Lab288P4bin103 | Isolate | Unclassified |
| 2 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 3 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 4 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 5 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 6 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 7 | 8025756023 | Caballeronia peredens LZ002 | Isolate | Coreidae |
| 8 | 8102161003 | Caballeronia sp. LZ002 | Isolate | Coreidae |
| 9 | 3300007142 | Ant gut microbial communities from Cephalotes grandinosus, Brazil | Metagenome | Formicidae |
| 10 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 11 | 2820047982 | Unclassified Proteobacteria Th196P3bin67 | Isolate | Unclassified |
| 12 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 13 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 14 | 8102060671 | Caballeronia sp. GAFFF2 | Isolate | Coreidae |
| 15 | 8102152052 | Caballeronia sp. LZ001 | Isolate | Coreidae |
| 16 | 3300002931 | Ant worker gut metagenome for colony PL010 | Metagenome | Formicidae |
| 17 | 3300002934 | Ant worker gut metagenome for colony PL005 | Metagenome | Formicidae |
| 18 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 19 | 3300007052 | Ant gut microbial communities from Cephalotes eduarduli, Brazil | Metagenome | Formicidae |
| 20 | 3300007192 | Ant gut microbial communities from Cephalotes persimplex, Brazil | Metagenome | Formicidae |
| 21 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 22 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 23 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 24 | 3300012839 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG | Metagenome | Culicidae |
| 25 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 26 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 27 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 28 | 2864937364 | Acidovorax soli S00198 | Isolate | Elmidae |
| 29 | 2963630348 | Burkholderiales bacterium 3487_49 | Isolate | Formicidae |
| 30 | 2820050117 | Unclassified Proteobacteria Th196P3bin129 | Isolate | Unclassified |
| 31 | 2820086750 | Unclassified Proteobacteria Lab288P3bin98 | Isolate | Unclassified |
| 32 | 2820157249 | Unclassified Proteobacteria Cu122P4bin11 | Isolate | Unclassified |
| 33 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 34 | 8102074813 | Caballeronia sp. GAWG1-1 | Isolate | Coreidae |
| 35 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 36 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 37 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 38 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 39 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 40 | 2820121232 | Unclassified Proteobacteria Emb289P4bin32 | Isolate | Unclassified |
| 41 | 2820164216 | Unclassified Proteobacteria Cu122P1bin22 | Isolate | Unclassified |
| 42 | 8023724303 | Caballeronia zhejiangensis LP003 | Isolate | Coreidae |
| 43 | 8024001094 | Caballeronia sp. TF1N1 | Isolate | Berytidae |
| 44 | 8102041249 | Caballeronia sp. GACF4 | Isolate | Coreidae |
| 45 | 8102087471 | Caballeronia sp. GAWG2-1 | Isolate | Coreidae |
| 46 | 3300007141 | Ant gut microbial communities from Cephalotes maculatus, Brazil | Metagenome | Formicidae |
| 47 | 3300007188 | Ant gut microbial communities from Cephalotes rohweri, Arizona, USA | Metagenome | Formicidae |
| 48 | 3300012835 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E1 MG | Metagenome | Culicidae |
| 49 | 3300012837 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E6 MG | Metagenome | Armadillidiidae |
| 50 | 3300012849 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG | Metagenome | Culicidae |
| 51 | 3300012850 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E0 MG | Metagenome | Culicidae |
| 52 | 3300012854 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E1 MG | Metagenome | Culicidae |
| 53 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 54 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 55 | 2864812326 | Chitinimonas taiwanensis S00057 | Isolate | Elmidae |
| 56 | 2687453742 | Burkholderiales bacterium B_Cag20 | Isolate | Unclassified |
| 57 | 8023757577 | Caballeronia peredens LP006 | Isolate | Coreidae |
| 58 | 8023764196 | Caballeronia peredens LZ001 | Isolate | Coreidae |
| 59 | 8025747911 | Caballeronia peredens LZ003 | Isolate | Coreidae |
| 60 | 3300007083 | Ant gut microbial communities from Cephalotes persimilis, Brazil | Metagenome | Formicidae |
| 61 | 3300007140 | Ant gut microbial communities from Cephalotes pallens, Brazil | Metagenome | Formicidae |
| 62 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 63 | 3300012806 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E1 MG | Metagenome | |
| 64 | 2687453753 | Burkholderiales bacterium B_Cag25 | Isolate | Unclassified |
| 65 | 8102145433 | Caballeronia sp. LP006 | Isolate | Coreidae |
| 66 | 3300002938 | Larval gut metagenome for colony PL005 | Metagenome | Formicidae |
| 67 | 3300007095 | Ant gut microbial communities from Cephalotes minutus, Brazil | Metagenome | Formicidae |
| 68 | 3300012813 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E11 MG | Metagenome | Culicidae |
| 69 | 3300012852 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E0 MG | Metagenome | |
| 70 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 71 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 72 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 73 | 2603880165 | Burkholderiales A1 | Isolate | Unclassified |
| 74 | 2603880170 | Burkholderiales A2 | Isolate | Unclassified |
| 75 | 2603880172 | Burkholderiales C | Isolate | Unclassified |
| 76 | 2820089333 | Unclassified Proteobacteria Lab288P3bin88 | Isolate | Unclassified |
| 77 | 3300012798 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E6 MG | Metagenome | |
| 78 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 79 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 80 | 2864808494 | Chitinimonas taiwanensis S00056 | Isolate | Elmidae |
| 81 | 2820071837 | Unclassified Proteobacteria Nt197P3bin132 | Isolate | Unclassified |
| 82 | 2820077244 | Unclassified Proteobacteria Lab288P4bin72 | Isolate | Unclassified |
| 83 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 84 | 8024019580 | Caballeronia sp. Lep1P3 | Isolate | Coreidae |
| 85 | 3300007067 | Ant gut microbial communities from Cephalotes spinosus, Peru | Metagenome | Formicidae |
| 86 | 3300007139 | Ant gut microbial communities from Cephalotes pellans, Brazil | Metagenome | Formicidae |
| 87 | 3300012820 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E6 MG | Metagenome | Armadillidiidae |
| 88 | 3300012861 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E0 MG | Metagenome | Culicidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466734_054965 | 3300042623 | Bacteria | 58378 |
| 2 | Ga0466702_398182 | 3300042635 | Bacteria | 1565 |
| 3 | Ga0466725_155815 | 3300042654 | Bacteria | 22403 |
| 4 | Ga0466729_015681 | 3300042621 | Bacteria | 43972 |
| 5 | Ga0466729_147660 | 3300042621 | Bacteria | 14768 |
| 6 | CVPL005L_10000182 | 3300002938 | Bacteria | 52318 |
| 7 | Ga0102740_1000258 | 3300007140 | Unclassified | 15056 |
| 8 | Ga0103264_1005183 | 3300007188 | Bacteria | 6178 |
| 9 | Ga0103268_1100790 | 3300007192 | Bacteria | 718 |
| 10 | Ga0160447_101987 | 3300012849 | Bacteria | 7510 |
| 11 | Ga0466657_106875 | 3300042582 | Bacteria | 3354 |
| 12 | Ga0466704_481878 | 3300042643 | Bacteria | 4214 |
| 13 | Ga0466725_061251 | 3300042654 | Bacteria | 41948 |
| 14 | Ga0466701_089860 | 3300042598 | Bacteria | 2119 |
| 15 | Ga0466707_122282 | 3300042601 | Bacteria | 11801 |
| 16 | Ga0466722_069269 | 3300042609 | Bacteria | 7749 |
| 17 | Ga0466718_158112 | 3300042617 | Bacteria | 6268 |
| 18 | CVPL005W_1000290 | 3300002934 | Bacteria | 23148 |
| 19 | Ga0102737_1000500 | 3300007142 | Bacteria | 12775 |
| 20 | Ga0103264_1022309 | 3300007188 | Bacteria | 3057 |
| 21 | Ga0123353_10465472 | 3300010167 | Bacteria | 1856 |
| 22 | Ga0123354_10000011 | 3300010882 | Bacteria | 166906 |
| 23 | Ga0160454_100286 | 3300012798 | Unclassified | 43568 |
| 24 | Ga0160442_100345 | 3300012806 | Bacteria | 20896 |
| 25 | Ga0160442_102535 | 3300012806 | Unclassified | 2000 |
| 26 | Ga0466733_003157 | 3300042659 | Bacteria | 6825 |
| 27 | Ga0160447_102087 | 3300012849 | Unclassified | 7277 |
| 28 | Ga0160434_102198 | 3300012850 | Unclassified | 3409 |
| 29 | Ga0466657_108328 | 3300042582 | Bacteria | 20292 |
| 30 | Ga0466657_288832 | 3300042582 | Bacteria | 2613 |
| 31 | Ga0466708_431611 | 3300042652 | Bacteria | 17147 |
| 32 | Ga0466725_073293 | 3300042654 | Bacteria | 17506 |
| 33 | Ga0466725_224469 | 3300042654 | Bacteria | 3705 |
| 34 | Ga0466725_279702 | 3300042654 | Bacteria | 9622 |
| 35 | Ga0466706_255684 | 3300042599 | Bacteria | 11021 |
| 36 | Ga0466711_359037 | 3300042615 | Bacteria | 49677 |
| 37 | Ga0466726_206224 | 3300042619 | Bacteria | 2253 |
| 38 | CVPL010W_10000642 | 3300002931 | Bacteria | 63793 |
| 39 | CVPL010W_10002361 | 3300002931 | Bacteria | 22172 |
| 40 | Ga0103264_1000167 | 3300007188 | Bacteria | 38299 |
| 41 | Ga0103264_1001163 | 3300007188 | Bacteria | 11640 |
| 42 | Ga0103264_1002826 | 3300007188 | Bacteria | 7895 |
| 43 | Ga0160456_100062 | 3300012820 | Bacteria | 160272 |
| 44 | Ga0160472_106238 | 3300012839 | Bacteria | 1797 |
| 45 | Ga0160436_1008249 | 3300012861 | Bacteria | 2349 |
| 46 | Ga0466723_179140 | 3300042618 | Bacteria | 23043 |
| 47 | CVPL005W_1000164 | 3300002934 | Bacteria | 28912 |
| 48 | Ga0102738_1000175 | 3300007141 | Bacteria | 15128 |
| 49 | Ga0103264_1001861 | 3300007188 | Bacteria | 9374 |
| 50 | Ga0103264_1002224 | 3300007188 | Bacteria | 14098 |
| 51 | Ga0123356_10026887 | 3300010049 | Unclassified | 5396 |
| 52 | Ga0123356_10198688 | 3300010049 | Unclassified | 2043 |
| 53 | Ga0160455_100078 | 3300012837 | Bacteria | 160114 |
| 54 | Ga0160472_104506 | 3300012839 | Unclassified | 2431 |
| 55 | Ga0160430_103344 | 3300012852 | Bacteria | 4496 |
| 56 | Ga0466657_011395 | 3300042582 | Bacteria | 32120 |
| 57 | Ga0466691_084271 | 3300042593 | Bacteria | 8904 |
| 58 | Ga0466695_223236 | 3300042595 | Bacteria | 5080 |
| 59 | Ga0466734_137166 | 3300042623 | Bacteria | 5207 |
| 60 | Ga0466725_293813 | 3300042654 | Bacteria | 93076 |
| 61 | Ga0466706_135596 | 3300042599 | Bacteria | 1530 |
| 62 | Ga0466710_309923 | 3300042613 | Bacteria | 3058 |
| 63 | CVPL010W_10014803 | 3300002931 | Bacteria | 5618 |
| 64 | Ga0072941_1262882 | 3300005201 | Bacteria | 1823 |
| 65 | Ga0102736_1000492 | 3300007052 | Bacteria | 7977 |
| 66 | Ga0103261_1000946 | 3300007083 | Bacteria | 4502 |
| 67 | Ga0103264_1000392 | 3300007188 | Bacteria | 23019 |
| 68 | Ga0123353_10372288 | 3300010167 | Bacteria | 2141 |
| 69 | Ga0466734_061146 | 3300042623 | Bacteria | 4152 |
| 70 | Ga0466709_087959 | 3300042648 | Bacteria | 13518 |
| 71 | Ga0466726_170278 | 3300042619 | Bacteria | 26200 |
| 72 | Ga0466729_061556 | 3300042621 | Bacteria | 1897 |
| 73 | CVPL010W_10002342 | 3300002931 | Bacteria | 23217 |
| 74 | CVPL010W_10010421 | 3300002931 | Bacteria | 8279 |
| 75 | Ga0103261_1003184 | 3300007083 | Bacteria | 2564 |
| 76 | Ga0103260_1001578 | 3300007139 | Bacteria | 4030 |
| 77 | Ga0102737_1009309 | 3300007142 | Unclassified | 1696 |
| 78 | Ga0123353_10172660 | 3300010167 | Bacteria | 3430 |
| 79 | Ga0466697_187703 | 3300042611 | Bacteria | 2648 |
| 80 | Ga0466705_236309 | 3300042612 | Bacteria | 1399 |
| 81 | Ga0466657_133978 | 3300042582 | Bacteria | 2904 |
| 82 | Ga0466692_135261 | 3300042591 | Bacteria | 88396 |
| 83 | Ga0466704_477248 | 3300042643 | Bacteria | 2467 |
| 84 | Ga0466707_298762 | 3300042601 | Bacteria | 1066 |
| 85 | Ga0466710_131881 | 3300042613 | Bacteria | 4045 |
| 86 | Ga0466715_574611 | 3300042616 | Bacteria | 1831 |
| 87 | CVPL010W_10009054 | 3300002931 | Bacteria | 10119 |
| 88 | CVPL005L_10000196 | 3300002938 | Unclassified | 51126 |
| 89 | Ga0102739_1006043 | 3300007095 | Bacteria | 1639 |
| 90 | Ga0102737_1003418 | 3300007142 | Unclassified | 3631 |
| 91 | Ga0103264_1000200 | 3300007188 | Bacteria | 34676 |
| 92 | Ga0103268_1000550 | 3300007192 | Bacteria | 11219 |
| 93 | Ga0123357_10000808 | 3300009784 | Bacteria | 31648 |
| 94 | Ga0160446_110234 | 3300012835 | Bacteria | 1199 |
| 95 | Ga0160447_111116 | 3300012849 | Bacteria | 1925 |
| 96 | Ga0160448_111828 | 3300012854 | Unclassified | 1755 |
| 97 | Ga0466704_349948 | 3300042643 | Bacteria | 1559 |
| 98 | Ga0466724_10719 | 3300042649 | Bacteria | 2339 |
| 99 | Ga0466708_251180 | 3300042652 | Bacteria | 15531 |
| 100 | Ga0466725_321110 | 3300042654 | Bacteria | 5740 |
| 101 | Ga0466707_062325 | 3300042601 | Bacteria | 2963 |
| 102 | Ga0466715_143205 | 3300042616 | Bacteria | 113538 |
| 103 | Ga0103266_1000826 | 3300007067 | Bacteria | 5693 |
| 104 | Ga0103261_1005167 | 3300007083 | Bacteria | 1938 |
| 105 | Ga0102737_1009389 | 3300007142 | Bacteria | 1684 |
| 106 | Ga0103264_1000121 | 3300007188 | Bacteria | 51991 |
| 107 | Ga0123353_10011890 | 3300010167 | Bacteria | 12309 |
| 108 | Ga0160470_100139 | 3300012813 | Bacteria | 72449 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.