Protein Family IF10264
Metagenome
Isolate
354
Members
79
Samples
326
Scaffolds
369.6
Avg Length
Representative Sequence
- ID
- 3300042656|Ga0466732_438604|Ga0466732_438604_2115_3362
- Length
- 415 aa
- Sequence
- MSILRIDLNSFGGYIFTIGKRLLVKSSKKSHKIPVGACTMKKNAFYLILGGIVITSVLFGACRKSSGTSSAAQSEKESAGITVRLLTDATGVDDKSFNAAAWRGILEFYGDTWQNQSKRGKLYDVVTAQTQDMYIPNIRQATDEGFDLIVTTGFTFADALDTVAKQNPKQNYVIVDVDWVNLPNVMQAMYAEHEGSYLVGVATALKAKADGIANPRFGFIGGVPGAVITKFEVGYVQGILSVFPNAQIVDYYANDWGRPDLAKTQAKNWYDSGVYAIYSAAGGTGNGTIAQAKEYRLEGKNVWAIGVDSDQHEEGLYNATDSAVLTSMIKRVETSLIYALRSVQNKTFRGEVIVFDLQADGVGYSDTNSALTNDIKSELENIKRQIVSGWIKIAATYADAKQLPGFPQDLKAMDN
Sample Types
Isolate
7.9%
Metagenome
92.1%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
35.5%
Unclassified
30.3%
Kalotermitidae
19.7%
Culicidae
5.3%
Rhinotermitidae
3.9%
Termopsidae
3.9%
Blaberidae
1.3%
Taxonomy
Archaea
0
Bacteria
335
Eukaryota
0
Viruses
0
Unclassified
19
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2781125638 | Treponema sp. Co191P1bin8 | Isolate | Unclassified |
| 2 | 2781125652 | Treponema sp. Cu122P5bin1 | Isolate | Unclassified |
| 3 | 2781125661 | Treponema sp. Emb289P3bin69 | Isolate | Unclassified |
| 4 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 5 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 6 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 7 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 8 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 9 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 10 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 11 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 12 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 13 | 2964144231 | Entomospira culicis BR151 | Isolate | Culicidae |
| 14 | 2781125643 | Treponema sp. Co191P3bin45 | Isolate | Unclassified |
| 15 | 2781125664 | Treponema sp. Emb289P3bin139 | Isolate | Unclassified |
| 16 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 17 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 18 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 19 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 20 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 21 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 22 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 23 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 24 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 25 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 26 | 2781125657 | Treponema sp. Emb289P3bin15 | Isolate | Unclassified |
| 27 | 2781125693 | Treponema sp. Th196P3bin148 | Isolate | Unclassified |
| 28 | 2781125694 | Treponema sp. Th196P3bin120 | Isolate | Unclassified |
| 29 | 8063595521 | Entomospira culicis BR149 | Isolate | Culicidae |
| 30 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 31 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 32 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 33 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 34 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 35 | 2964145936 | Entomospira culicis BR149 | Isolate | Culicidae |
| 36 | 2781125660 | Treponema sp. Emb289P3bin52 | Isolate | Unclassified |
| 37 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 38 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 39 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 40 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 41 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 42 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 43 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 44 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 45 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 46 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 47 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 48 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 49 | 2503904012 | Sphaerochaeta coccoides SPN1, DSM 17374 | Isolate | Kalotermitidae |
| 50 | 2772190975 | Treponema sp. RmG30 | Isolate | Blaberidae |
| 51 | 2781125646 | Treponema sp. Co191P3bin59 | Isolate | Unclassified |
| 52 | 2781125692 | Treponema sp. Th196P3bin31 | Isolate | Unclassified |
| 53 | 650716099 | Leadbettera azotonutricia ZAS-9 | Isolate | Unclassified |
| 54 | 3300005485 | Termite gut microbial communities from Costa Rica - P3 luminal contents | Metagenome | Termitidae |
| 55 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 56 | 2781125658 | Treponema sp. Emb289P3bin37 | Isolate | Unclassified |
| 57 | 2781125688 | Treponema sp. Lab288P4bin13 | Isolate | Unclassified |
| 58 | 2781125690 | Treponema sp. Th196P3bin63 | Isolate | Unclassified |
| 59 | 2781125691 | Treponema sp. Th196P3bin73 | Isolate | Unclassified |
| 60 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 61 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 62 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 63 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 64 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 65 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 66 | 2772190978 | Treponema sp. Nt197P3bin57 | Isolate | Unclassified |
| 67 | 2781125636 | Treponema sp. Co191P1bin67 | Isolate | Unclassified |
| 68 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 69 | 3300001880 | Termite hindgut microbial communities from the Max Planck Institute, Bremen, Germany, analyzing fibers in the hindgut lumen - ASSEMBLED Fiber-Associated Metagenome | Metagenome | |
| 70 | 2781125631 | Treponema sp. Nt197P3bin89 | Isolate | Unclassified |
| 71 | 2781125663 | Treponema sp. Emb289P3bin135 | Isolate | Unclassified |
| 72 | 2781125665 | Treponema sp. Emb289P3bin117 | Isolate | Unclassified |
| 73 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 74 | 8063597228 | Entomospira culicis BR151 | Isolate | Culicidae |
| 75 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 76 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 77 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 78 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 79 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466732_153173 | 3300042656 | Bacteria | 9104 |
| 2 | Ga0466733_020925 | 3300042659 | Bacteria | 34524 |
| 3 | Ga0466703_023160 | 3300042636 | Bacteria | 7155 |
| 4 | Ga0466703_081571 | 3300042636 | Unclassified | 2200 |
| 5 | Ga0466704_493805 | 3300042643 | Bacteria | 1249 |
| 6 | Ga0466708_044265 | 3300042652 | Bacteria | 2640 |
| 7 | Ga0466708_410626 | 3300042652 | Bacteria | 3210 |
| 8 | Ga0466700_299402 | 3300042600 | Unclassified | 1354 |
| 9 | Ga0466716_108451 | 3300042605 | Bacteria | 4582 |
| 10 | Ga0466716_388314 | 3300042605 | Bacteria | 3759 |
| 11 | Ga0466720_088235 | 3300042607 | Bacteria | 5571 |
| 12 | Ga0466698_122171 | 3300042610 | Bacteria | 2199 |
| 13 | Ga0415639_168073 | 3300038395 | Unclassified | 2741 |
| 14 | Ga0466690_094096 | 3300042590 | Bacteria | 3041 |
| 15 | Ga0466690_164597 | 3300042590 | Bacteria | 9013 |
| 16 | Ga0466692_006573 | 3300042591 | Unclassified | 3208 |
| 17 | Ga0466694_035702 | 3300042594 | Bacteria | 3004 |
| 18 | Ga0466699_056258 | 3300042597 | Bacteria | 3765 |
| 19 | Ga0466699_239977 | 3300042597 | Bacteria | 1525 |
| 20 | Ga0123357_10242677 | 3300009784 | Bacteria | 1947 |
| 21 | Ga0123357_10269501 | 3300009784 | Bacteria | 1782 |
| 22 | Ga0123356_10007118 | 3300010049 | Bacteria | 11207 |
| 23 | Ga0123356_10021430 | 3300010049 | Bacteria | 6098 |
| 24 | Ga0123356_10097620 | 3300010049 | Bacteria | 2812 |
| 25 | Ga0123353_10054287 | 3300010167 | Bacteria | 6407 |
| 26 | Ga0123353_10079009 | 3300010167 | Bacteria | 5289 |
| 27 | Ga0123353_10749687 | 3300010167 | Bacteria | 1359 |
| 28 | Ga0466712_092522 | 3300042614 | Bacteria | 6138 |
| 29 | Ga0466712_096882 | 3300042614 | Bacteria | 42313 |
| 30 | Ga0466712_099702 | 3300042614 | Unclassified | 2476 |
| 31 | Ga0466712_173885 | 3300042614 | Bacteria | 11067 |
| 32 | Ga0466712_218779 | 3300042614 | Bacteria | 4331 |
| 33 | Ga0466715_031439 | 3300042616 | Bacteria | 3623 |
| 34 | Ga0466718_011200 | 3300042617 | Bacteria | 17872 |
| 35 | Ga0466718_055605 | 3300042617 | Bacteria | 94458 |
| 36 | Ga0466718_084111 | 3300042617 | Bacteria | 36391 |
| 37 | Ga0466718_117961 | 3300042617 | Bacteria | 51293 |
| 38 | Ga0466723_141115 | 3300042618 | Bacteria | 47726 |
| 39 | Ga0466723_154973 | 3300042618 | Bacteria | 7689 |
| 40 | JGI24698J34947_10006681 | 3300002449 | Bacteria | 6334 |
| 41 | JGI24698J34947_10055129 | 3300002449 | Unclassified | 1982 |
| 42 | JGI24698J34947_10065544 | 3300002449 | Bacteria | 1770 |
| 43 | JGI24698J34947_10079458 | 3300002449 | Unclassified | 1544 |
| 44 | JGI24695J34938_10000595 | 3300002450 | Bacteria | 34813 |
| 45 | JGI24695J34938_10001004 | 3300002450 | Bacteria | 25624 |
| 46 | JGI24695J34938_10001318 | 3300002450 | Bacteria | 21600 |
| 47 | JGI24702J35022_10001092 | 3300002462 | Bacteria | 16861 |
| 48 | JGI24702J35022_10018336 | 3300002462 | Bacteria | 3818 |
| 49 | Ga0072940_1220206 | 3300005200 | Bacteria | 1501 |
| 50 | Ga0466705_014093 | 3300042612 | Unclassified | 17056 |
| 51 | Ga0466731_023758 | 3300042622 | Bacteria | 3268 |
| 52 | Ga0466731_340918 | 3300042622 | Bacteria | 2450 |
| 53 | Ga0466735_137745 | 3300042624 | Bacteria | 19575 |
| 54 | Ga0466702_190301 | 3300042635 | Bacteria | 6283 |
| 55 | Ga0466702_197588 | 3300042635 | Bacteria | 25284 |
| 56 | Ga0466703_010769 | 3300042636 | Bacteria | 8615 |
| 57 | Ga0466703_172582 | 3300042636 | Bacteria | 5498 |
| 58 | Ga0466704_465796 | 3300042643 | Bacteria | 55836 |
| 59 | Ga0466708_015945 | 3300042652 | Bacteria | 20990 |
| 60 | Ga0466727_175917 | 3300042655 | Bacteria | 1406 |
| 61 | Ga0466716_497733 | 3300042605 | Bacteria | 1616 |
| 62 | Ga0466722_150430 | 3300042609 | Bacteria | 10752 |
| 63 | Ga0466722_237965 | 3300042609 | Bacteria | 34947 |
| 64 | Ga0466698_381908 | 3300042610 | Bacteria | 7152 |
| 65 | Ga0415639_031365 | 3300038395 | Bacteria | 2073 |
| 66 | Ga0466690_036534 | 3300042590 | Bacteria | 9076 |
| 67 | Ga0466692_031147 | 3300042591 | Bacteria | 21130 |
| 68 | Ga0466692_126936 | 3300042591 | Bacteria | 15927 |
| 69 | Ga0466691_150768 | 3300042593 | Bacteria | 5489 |
| 70 | Ga0466696_376541 | 3300042596 | Bacteria | 8569 |
| 71 | Ga0466699_004293 | 3300042597 | Bacteria | 3145 |
| 72 | Ga0466699_114319 | 3300042597 | Bacteria | 5288 |
| 73 | Ga0466699_220255 | 3300042597 | Bacteria | 2918 |
| 74 | Ga0466699_321601 | 3300042597 | Bacteria | 4762 |
| 75 | Ga0123353_10102323 | 3300010167 | Bacteria | 4617 |
| 76 | Ga0123354_10275686 | 3300010882 | Bacteria | 1645 |
| 77 | Ga0466712_288909 | 3300042614 | Bacteria | 9560 |
| 78 | Ga0466711_011037 | 3300042615 | Bacteria | 4152 |
| 79 | Ga0466711_366268 | 3300042615 | Bacteria | 22616 |
| 80 | Ga0466718_023197 | 3300042617 | Bacteria | 23195 |
| 81 | Ga0466718_052912 | 3300042617 | Bacteria | 2809 |
| 82 | Ga0466723_072931 | 3300042618 | Bacteria | 4935 |
| 83 | Ga0466723_118185 | 3300042618 | Bacteria | 11759 |
| 84 | Ga0466723_130490 | 3300042618 | Bacteria | 37311 |
| 85 | Ga0466726_180409 | 3300042619 | Bacteria | 30889 |
| 86 | Ga0466728_119785 | 3300042620 | Bacteria | 8180 |
| 87 | AustNasuHG_c1017986 | 3300000089 | Bacteria | 2338 |
| 88 | FAAS_10002690 | 3300001880 | Bacteria | 1214 |
| 89 | JGI24698J34947_10011909 | 3300002449 | Unclassified | 4776 |
| 90 | JGI24695J34938_10001556 | 3300002450 | Bacteria | 19325 |
| 91 | Ga0072941_1019378 | 3300005201 | Bacteria | 5689 |
| 92 | Ga0072941_1029807 | 3300005201 | Bacteria | 4416 |
| 93 | Ga0072941_1046653 | 3300005201 | Bacteria | 1397 |
| 94 | Ga0466705_184316 | 3300042612 | Bacteria | 20594 |
| 95 | Ga0466731_419296 | 3300042622 | Bacteria | 3225 |
| 96 | Ga0466709_154784 | 3300042648 | Bacteria | 8458 |
| 97 | Ga0466709_238027 | 3300042648 | Bacteria | 40916 |
| 98 | Ga0466708_142901 | 3300042652 | Bacteria | 7737 |
| 99 | Ga0466708_162158 | 3300042652 | Bacteria | 28148 |
| 100 | Ga0466708_181694 | 3300042652 | Bacteria | 6341 |
| 101 | Ga0466708_274791 | 3300042652 | Bacteria | 4317 |
| 102 | Ga0466713_086597 | 3300042602 | Bacteria | 4910 |
| 103 | Ga0466717_047953 | 3300042604 | Bacteria | 1703 |
| 104 | Ga0466717_148809 | 3300042604 | Bacteria | 2200 |
| 105 | Ga0466719_126760 | 3300042606 | Bacteria | 30509 |
| 106 | Ga0466698_431584 | 3300042610 | Bacteria | 2431 |
| 107 | Ga0264413_115925 | 3300024493 | Bacteria | 5159 |
| 108 | Ga0466693_224584 | 3300042592 | Bacteria | 5795 |
| 109 | Ga0466691_194002 | 3300042593 | Bacteria | 13239 |
| 110 | Ga0466694_238534 | 3300042594 | Bacteria | 1545 |
| 111 | Ga0466694_312789 | 3300042594 | Bacteria | 1695 |
| 112 | Ga0466699_049626 | 3300042597 | Unclassified | 9230 |
| 113 | Ga0466699_351348 | 3300042597 | Bacteria | 43572 |
| 114 | Ga0123357_10278176 | 3300009784 | Bacteria | 1734 |
| 115 | Ga0123356_10000894 | 3300010049 | Bacteria | 32978 |
| 116 | Ga0123356_10018169 | 3300010049 | Bacteria | 6677 |
| 117 | Ga0123353_10202812 | 3300010167 | Bacteria | 3119 |
| 118 | Ga0466712_028735 | 3300042614 | Bacteria | 38990 |
| 119 | Ga0466712_056710 | 3300042614 | Bacteria | 20764 |
| 120 | Ga0466712_102622 | 3300042614 | Bacteria | 3285 |
| 121 | Ga0466711_306450 | 3300042615 | Bacteria | 10352 |
| 122 | Ga0466715_432215 | 3300042616 | Unclassified | 3851 |
| 123 | Ga0466723_027830 | 3300042618 | Bacteria | 7659 |
| 124 | Ga0466723_184050 | 3300042618 | Bacteria | 1840 |
| 125 | Ga0466726_153814 | 3300042619 | Bacteria | 13563 |
| 126 | Ga0466728_186993 | 3300042620 | Bacteria | 14174 |
| 127 | JGI24698J34947_10001517 | 3300002449 | Bacteria | 12274 |
| 128 | JGI24698J34947_10006509 | 3300002449 | Bacteria | 6409 |
| 129 | Ga0466705_127452 | 3300042612 | Bacteria | 4604 |
| 130 | Ga0466705_189228 | 3300042612 | Bacteria | 5807 |
| 131 | Ga0466732_079090 | 3300042656 | Bacteria | 11981 |
| 132 | Ga0466702_106319 | 3300042635 | Bacteria | 1396 |
| 133 | Ga0466709_262235 | 3300042648 | Bacteria | 9244 |
| 134 | Ga0466708_060659 | 3300042652 | Bacteria | 41764 |
| 135 | Ga0466727_070256 | 3300042655 | Bacteria | 16848 |
| 136 | Ga0466727_289795 | 3300042655 | Bacteria | 4854 |
| 137 | Ga0466707_264658 | 3300042601 | Bacteria | 1469 |
| 138 | Ga0466717_215874 | 3300042604 | Bacteria | 3193 |
| 139 | Ga0466722_008938 | 3300042609 | Bacteria | 4281 |
| 140 | Ga0466722_033648 | 3300042609 | Bacteria | 24401 |
| 141 | Ga0264413_120111 | 3300024493 | Bacteria | 2799 |
| 142 | Ga0466692_060874 | 3300042591 | Bacteria | 8658 |
| 143 | Ga0466694_092760 | 3300042594 | Bacteria | 30658 |
| 144 | Ga0466694_111196 | 3300042594 | Bacteria | 2257 |
| 145 | Ga0466694_268885 | 3300042594 | Bacteria | 17270 |
| 146 | Ga0466699_275623 | 3300042597 | Bacteria | 1505 |
| 147 | Ga0123356_10245198 | 3300010049 | Bacteria | 1865 |
| 148 | Ga0466712_151549 | 3300042614 | Bacteria | 36591 |
| 149 | Ga0466712_314580 | 3300042614 | Bacteria | 1417 |
| 150 | Ga0466711_026776 | 3300042615 | Bacteria | 65764 |
| 151 | Ga0466723_096781 | 3300042618 | Bacteria | 12623 |
| 152 | Ga0466723_125014 | 3300042618 | Bacteria | 22242 |
| 153 | Ga0466723_126788 | 3300042618 | Bacteria | 3162 |
| 154 | Ga0466723_342929 | 3300042618 | Bacteria | 1450 |
| 155 | Ga0466726_046417 | 3300042619 | Bacteria | 1430 |
| 156 | Ga0466726_374212 | 3300042619 | Bacteria | 1299 |
| 157 | JGI24698J34947_10081289 | 3300002449 | Unclassified | 1519 |
| 158 | JGI24695J34938_10002052 | 3300002450 | Bacteria | 15874 |
| 159 | JGI24695J34938_10008622 | 3300002450 | Bacteria | 5795 |
| 160 | JGI24695J34938_10012985 | 3300002450 | Bacteria | 4391 |
| 161 | JGI24695J34938_10041370 | 3300002450 | Bacteria | 2069 |
| 162 | Ga0072941_1005178 | 3300005201 | Bacteria | 41250 |
| 163 | Ga0072941_1029766 | 3300005201 | Bacteria | 6238 |
| 164 | Ga0466705_333017 | 3300042612 | Bacteria | 12845 |
| 165 | Ga0466732_029316 | 3300042656 | Bacteria | 1899 |
| 166 | Ga0466732_357339 | 3300042656 | Bacteria | 5585 |
| 167 | Ga0466733_205360 | 3300042659 | Bacteria | 4331 |
| 168 | Ga0466731_090012 | 3300042622 | Bacteria | 2176 |
| 169 | Ga0466704_033321 | 3300042643 | Bacteria | 22698 |
| 170 | Ga0466704_239917 | 3300042643 | Bacteria | 52442 |
| 171 | Ga0466704_439686 | 3300042643 | Bacteria | 95559 |
| 172 | Ga0466708_083370 | 3300042652 | Bacteria | 6412 |
| 173 | Ga0466727_078204 | 3300042655 | Bacteria | 17353 |
| 174 | Ga0466707_229372 | 3300042601 | Bacteria | 2415 |
| 175 | Ga0466707_346280 | 3300042601 | Bacteria | 11571 |
| 176 | Ga0466714_027324 | 3300042603 | Bacteria | 2317 |
| 177 | Ga0466717_132126 | 3300042604 | Bacteria | 1902 |
| 178 | Ga0466720_072563 | 3300042607 | Bacteria | 5028 |
| 179 | Ga0466720_106830 | 3300042607 | Bacteria | 5562 |
| 180 | Ga0466722_164913 | 3300042609 | Bacteria | 5335 |
| 181 | Ga0466722_235177 | 3300042609 | Bacteria | 2305 |
| 182 | Ga0466698_117067 | 3300042610 | Bacteria | 2776 |
| 183 | Ga0466690_353561 | 3300042590 | Bacteria | 1614 |
| 184 | Ga0466696_202354 | 3300042596 | Bacteria | 13086 |
| 185 | Ga0466699_093847 | 3300042597 | Bacteria | 16641 |
| 186 | Ga0466699_171005 | 3300042597 | Bacteria | 5197 |
| 187 | Ga0466699_338698 | 3300042597 | Bacteria | 62334 |
| 188 | Ga0123357_10070417 | 3300009784 | Bacteria | 4645 |
| 189 | Ga0123357_10261860 | 3300009784 | Bacteria | 1826 |
| 190 | Ga0123353_10569592 | 3300010167 | Bacteria | 1628 |
| 191 | Ga0466712_105034 | 3300042614 | Bacteria | 39434 |
| 192 | Ga0466712_184954 | 3300042614 | Bacteria | 2627 |
| 193 | Ga0466711_022609 | 3300042615 | Bacteria | 17428 |
| 194 | Ga0466711_130707 | 3300042615 | Bacteria | 4833 |
| 195 | Ga0466718_076477 | 3300042617 | Bacteria | 7238 |
| 196 | Ga0466723_042015 | 3300042618 | Bacteria | 4550 |
| 197 | AustNasuHG_c1016679 | 3300000089 | Bacteria | 2452 |
| 198 | JGI24698J34947_10000786 | 3300002449 | Bacteria | 15778 |
| 199 | JGI24698J34947_10000922 | 3300002449 | Bacteria | 14920 |
| 200 | JGI24698J34947_10016338 | 3300002449 | Bacteria | 4029 |
| 201 | JGI24695J34938_10000034 | 3300002450 | Bacteria | 102252 |
| 202 | JGI24695J34938_10000090 | 3300002450 | Bacteria | 79670 |
| 203 | JGI24695J34938_10001895 | 3300002450 | Bacteria | 16940 |
| 204 | JGI24695J34938_10018839 | 3300002450 | Bacteria | 3436 |
| 205 | JGI24695J34938_10072606 | 3300002450 | Bacteria | 1435 |
| 206 | Ga0072941_1029806 | 3300005201 | Bacteria | 5029 |
| 207 | Ga0072941_1035469 | 3300005201 | Bacteria | 3071 |
| 208 | Ga0074263_116330 | 3300005485 | Bacteria | 1326 |
| 209 | Ga0466705_145950 | 3300042612 | Bacteria | 8002 |
| 210 | Ga0466733_092695 | 3300042659 | Bacteria | 7325 |
| 211 | Ga0466733_158626 | 3300042659 | Bacteria | 3723 |
| 212 | Ga0466709_100222 | 3300042648 | Bacteria | 20265 |
| 213 | Ga0466708_084610 | 3300042652 | Bacteria | 2999 |
| 214 | Ga0466719_173508 | 3300042606 | Bacteria | 1659 |
| 215 | Ga0466719_311600 | 3300042606 | Bacteria | 10777 |
| 216 | Ga0466722_122280 | 3300042609 | Bacteria | 1489 |
| 217 | Ga0466722_207637 | 3300042609 | Bacteria | 1817 |
| 218 | Ga0466722_243327 | 3300042609 | Bacteria | 3097 |
| 219 | Ga0264413_110190 | 3300024493 | Bacteria | 1270 |
| 220 | Ga0415639_001947 | 3300038395 | Bacteria | 11345 |
| 221 | Ga0415639_004451 | 3300038395 | Bacteria | 7993 |
| 222 | Ga0466693_195521 | 3300042592 | Bacteria | 30403 |
| 223 | Ga0466694_146769 | 3300042594 | Bacteria | 1337 |
| 224 | Ga0466696_152207 | 3300042596 | Bacteria | 33378 |
| 225 | Ga0466696_190486 | 3300042596 | Bacteria | 8187 |
| 226 | Ga0466699_171190 | 3300042597 | Bacteria | 6442 |
| 227 | Ga0466699_215671 | 3300042597 | Bacteria | 4897 |
| 228 | Ga0466699_343051 | 3300042597 | Unclassified | 1343 |
| 229 | Ga0123357_10013501 | 3300009784 | Bacteria | 10608 |
| 230 | Ga0123356_10004905 | 3300010049 | Bacteria | 13733 |
| 231 | Ga0123356_10073151 | 3300010049 | Bacteria | 3222 |
| 232 | Ga0123354_10024651 | 3300010882 | Bacteria | 9491 |
| 233 | Ga0466712_127955 | 3300042614 | Bacteria | 54818 |
| 234 | Ga0466712_152932 | 3300042614 | Bacteria | 25376 |
| 235 | Ga0466726_013371 | 3300042619 | Bacteria | 2334 |
| 236 | Ga0466726_377498 | 3300042619 | Bacteria | 1863 |
| 237 | Ga0466728_202652 | 3300042620 | Bacteria | 3210 |
| 238 | Ga0466728_365455 | 3300042620 | Bacteria | 3708 |
| 239 | JGI24698J34947_10000157 | 3300002449 | Bacteria | 26130 |
| 240 | JGI24698J34947_10003072 | 3300002449 | Bacteria | 9039 |
| 241 | JGI24698J34947_10076564 | 3300002449 | Unclassified | 1586 |
| 242 | JGI24699J35502_11123507 | 3300002509 | Bacteria | 3556 |
| 243 | Ga0072941_1014957 | 3300005201 | Bacteria | 5126 |
| 244 | Ga0466731_360493 | 3300042622 | Bacteria | 2212 |
| 245 | Ga0466702_034734 | 3300042635 | Bacteria | 2341 |
| 246 | Ga0466702_080396 | 3300042635 | Bacteria | 5762 |
| 247 | Ga0466704_039010 | 3300042643 | Bacteria | 4940 |
| 248 | Ga0466704_213712 | 3300042643 | Bacteria | 18540 |
| 249 | Ga0466709_088693 | 3300042648 | Bacteria | 1716 |
| 250 | Ga0466709_329850 | 3300042648 | Unclassified | 2433 |
| 251 | Ga0466708_006890 | 3300042652 | Bacteria | 6509 |
| 252 | Ga0466708_145383 | 3300042652 | Bacteria | 1890 |
| 253 | Ga0466707_298605 | 3300042601 | Bacteria | 4619 |
| 254 | Ga0466719_190072 | 3300042606 | Bacteria | 9720 |
| 255 | Ga0466722_037580 | 3300042609 | Bacteria | 16154 |
| 256 | Ga0466698_011176 | 3300042610 | Bacteria | 17753 |
| 257 | Ga0264413_110192 | 3300024493 | Bacteria | 5269 |
| 258 | Ga0415639_218850 | 3300038395 | Bacteria | 2252 |
| 259 | Ga0466690_107045 | 3300042590 | Bacteria | 5122 |
| 260 | Ga0466692_200845 | 3300042591 | Bacteria | 9707 |
| 261 | Ga0466694_045897 | 3300042594 | Bacteria | 4791 |
| 262 | Ga0466694_062250 | 3300042594 | Bacteria | 2701 |
| 263 | Ga0466695_129390 | 3300042595 | Bacteria | 20502 |
| 264 | Ga0466699_042162 | 3300042597 | Bacteria | 13543 |
| 265 | Ga0123356_10035425 | 3300010049 | Bacteria | 4663 |
| 266 | Ga0123356_10051936 | 3300010049 | Bacteria | 3813 |
| 267 | Ga0123356_10374946 | 3300010049 | Bacteria | 1554 |
| 268 | Ga0123353_10209150 | 3300010167 | Bacteria | 3061 |
| 269 | Ga0123353_10453916 | 3300010167 | Bacteria | 1886 |
| 270 | Ga0466712_058075 | 3300042614 | Bacteria | 53898 |
| 271 | Ga0466712_089913 | 3300042614 | Bacteria | 8427 |
| 272 | Ga0466712_183582 | 3300042614 | Bacteria | 2917 |
| 273 | Ga0466711_063460 | 3300042615 | Bacteria | 2171 |
| 274 | Ga0466711_104540 | 3300042615 | Bacteria | 2224 |
| 275 | Ga0466715_178126 | 3300042616 | Bacteria | 4779 |
| 276 | Ga0466718_034524 | 3300042617 | Bacteria | 3838 |
| 277 | Ga0466718_044216 | 3300042617 | Bacteria | 2484 |
| 278 | Ga0466718_071948 | 3300042617 | Bacteria | 2082 |
| 279 | Ga0466728_322995 | 3300042620 | Bacteria | 9365 |
| 280 | AustNasuHG_c1000005 | 3300000089 | Bacteria | 56942 |
| 281 | AustNasuHG_c1001923 | 3300000089 | Bacteria | 7477 |
| 282 | JGI24698J34947_10000446 | 3300002449 | Bacteria | 19121 |
| 283 | JGI24698J34947_10014311 | 3300002449 | Bacteria | 4320 |
| 284 | JGI24698J34947_10015456 | 3300002449 | Unclassified | 4154 |
| 285 | JGI24698J34947_10065563 | 3300002449 | Unclassified | 1770 |
| 286 | JGI24702J35022_10122361 | 3300002462 | Bacteria | 1438 |
| 287 | Ga0072940_1028866 | 3300005200 | Bacteria | 17554 |
| 288 | Ga0466732_438604 | 3300042656 | Bacteria | 8230 |
| 289 | Ga0466733_199666 | 3300042659 | Bacteria | 24852 |
| 290 | Ga0466702_262024 | 3300042635 | Bacteria | 19372 |
| 291 | Ga0466702_372528 | 3300042635 | Bacteria | 4345 |
| 292 | Ga0466703_093336 | 3300042636 | Bacteria | 2409 |
| 293 | Ga0466703_269230 | 3300042636 | Bacteria | 18267 |
| 294 | Ga0466709_285730 | 3300042648 | Bacteria | 15632 |
| 295 | Ga0466727_054107 | 3300042655 | Bacteria | 3456 |
| 296 | Ga0466700_234953 | 3300042600 | Bacteria | 1372 |
| 297 | Ga0466719_301996 | 3300042606 | Bacteria | 12195 |
| 298 | Ga0456237_0000230 | 3300041968 | Unclassified | 8146 |
| 299 | Ga0466690_342285 | 3300042590 | Bacteria | 5766 |
| 300 | Ga0466692_121098 | 3300042591 | Bacteria | 3044 |
| 301 | Ga0466692_187946 | 3300042591 | Bacteria | 1709 |
| 302 | Ga0466691_048288 | 3300042593 | Bacteria | 13768 |
| 303 | Ga0466691_089247 | 3300042593 | Bacteria | 6042 |
| 304 | Ga0466691_167865 | 3300042593 | Bacteria | 14514 |
| 305 | Ga0466694_228811 | 3300042594 | Bacteria | 1491 |
| 306 | Ga0466694_275628 | 3300042594 | Bacteria | 5744 |
| 307 | Ga0466699_220119 | 3300042597 | Bacteria | 3582 |
| 308 | Ga0466699_312367 | 3300042597 | Bacteria | 2187 |
| 309 | Ga0466699_331734 | 3300042597 | Bacteria | 11870 |
| 310 | Ga0466699_397793 | 3300042597 | Bacteria | 8005 |
| 311 | Ga0123356_10000046 | 3300010049 | Bacteria | 130593 |
| 312 | Ga0123353_10006753 | 3300010167 | Bacteria | 15373 |
| 313 | Ga0466712_002977 | 3300042614 | Bacteria | 8253 |
| 314 | Ga0466712_020250 | 3300042614 | Bacteria | 1289 |
| 315 | Ga0466712_313417 | 3300042614 | Bacteria | 20202 |
| 316 | Ga0466711_377295 | 3300042615 | Bacteria | 14854 |
| 317 | Ga0466715_049324 | 3300042616 | Bacteria | 5474 |
| 318 | Ga0466715_074501 | 3300042616 | Bacteria | 21288 |
| 319 | Ga0466718_150417 | 3300042617 | Bacteria | 2028 |
| 320 | Ga0466726_052098 | 3300042619 | Bacteria | 1601 |
| 321 | Ga0466728_307427 | 3300042620 | Bacteria | 1453 |
| 322 | JGI24698J34947_10072898 | 3300002449 | Bacteria | 1641 |
| 323 | JGI24698J34947_10084320 | 3300002449 | Unclassified | 1480 |
| 324 | Ga0072941_1002830 | 3300005201 | Bacteria | 61182 |
| 325 | Ga0072941_1004259 | 3300005201 | Bacteria | 32505 |
| 326 | Ga0072941_1029808 | 3300005201 | Bacteria | 2674 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF02608 | Bmp | ABC transporter substrate-binding protein PnrA-like | 86 | 395 | 0.91 |
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF02608 | GO:0005886 | plasma membrane | CC |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.