Protein Family IF10240
Metagenome
Isolate
239
Members
63
Samples
227
Scaffolds
273.08
Avg Length
Representative Sequence
- ID
- 3300042656|Ga0466732_141017|Ga0466732_141017_14807_15763
- Length
- 318 aa
- Sequence
- MLEGSAGGLLKTFTALPAPHTLTKNINEYFQFHVIIQQILINRRGIMLQIMLQLYNVRDELQKDFDGTLAEIAGIGYKHVELALGRAFGKTSAQFKDSLDKAGLSAISAHVPYRDMIADPEKEINFHIEIGCKYIVVPFLVDEDRSTGSNYEEVKKGIARLGEIVSKKGAVLLYHNHEFEFEKYNGKYALDDLFDSIPANFLQTEIDVCWARVGGVDPAEYILKYSGRSPVVHLKDFDSSNGGAIKAEYDLIGEAKKARTTGAFPFRAVGYGVQDIPGIIKASQKAGAEWFVVEQDLPSPGKTSIECARDSLDYLRKF
Sample Types
Isolate
5.0%
Metagenome
95.0%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
44.3%
Kalotermitidae
23.0%
Unclassified
21.3%
Rhinotermitidae
6.6%
Termopsidae
4.9%
Taxonomy
Archaea
0
Bacteria
218
Eukaryota
0
Viruses
0
Unclassified
21
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 2 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 3 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 4 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 5 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 6 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 7 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 8 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 9 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 10 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 11 | 2781125666 | Treponema sp. Emb289P4bin7 | Isolate | Unclassified |
| 12 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 13 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 14 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 15 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 16 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 17 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 18 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 19 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 20 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 21 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 22 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 23 | 2781125650 | Treponema sp. Co191P3bin64 | Isolate | Unclassified |
| 24 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 25 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 26 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 27 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 28 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 29 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 30 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 31 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 32 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 33 | 2781125693 | Treponema sp. Th196P3bin148 | Isolate | Unclassified |
| 34 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 35 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 36 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 37 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 38 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 39 | 2820272499 | Unclassified Firmicutes Th196P3bin18 | Isolate | Unclassified |
| 40 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 41 | 650716099 | Leadbettera azotonutricia ZAS-9 | Isolate | Unclassified |
| 42 | 2781125634 | Treponema sp. Co191P1bin45 | Isolate | Unclassified |
| 43 | 2781125688 | Treponema sp. Lab288P4bin13 | Isolate | Unclassified |
| 44 | 2781125690 | Treponema sp. Th196P3bin63 | Isolate | Unclassified |
| 45 | 2820267566 | Unclassified Firmicutes Th196P3bin33 | Isolate | Unclassified |
| 46 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 47 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 48 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 49 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 50 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 51 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 52 | 2781125686 | Treponema sp. Lab288P4bin22 | Isolate | Unclassified |
| 53 | 2820472365 | Unclassified Firmicutes Lab288P1bin87 | Isolate | Unclassified |
| 54 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 55 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 56 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 57 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 58 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 59 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 60 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 61 | 2781125632 | Treponema sp. Co191P1bin87 | Isolate | Unclassified |
| 62 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 63 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_169042 | 3300042612 | Bacteria | 5498 |
| 2 | Ga0466705_178366 | 3300042612 | Bacteria | 3842 |
| 3 | Ga0466733_159108 | 3300042659 | Bacteria | 2057 |
| 4 | Ga0466712_036537 | 3300042614 | Bacteria | 4483 |
| 5 | Ga0466715_053240 | 3300042616 | Bacteria | 4571 |
| 6 | Ga0466715_107422 | 3300042616 | Bacteria | 21570 |
| 7 | Ga0466718_114910 | 3300042617 | Bacteria | 12848 |
| 8 | Ga0466726_463224 | 3300042619 | Bacteria | 1432 |
| 9 | Ga0415639_114655 | 3300038395 | Bacteria | 2302 |
| 10 | Ga0466692_185134 | 3300042591 | Bacteria | 6483 |
| 11 | Ga0466692_193541 | 3300042591 | Bacteria | 27268 |
| 12 | Ga0466696_161743 | 3300042596 | Unclassified | 10436 |
| 13 | Ga0466699_036524 | 3300042597 | Bacteria | 6473 |
| 14 | Ga0466699_078770 | 3300042597 | Bacteria | 26937 |
| 15 | Ga0466699_146841 | 3300042597 | Unclassified | 4877 |
| 16 | Ga0466703_144833 | 3300042636 | Bacteria | 2168 |
| 17 | Ga0466704_117169 | 3300042643 | Bacteria | 3866 |
| 18 | Ga0466704_529216 | 3300042643 | Bacteria | 37695 |
| 19 | Ga0466709_276718 | 3300042648 | Bacteria | 11568 |
| 20 | Ga0466708_224732 | 3300042652 | Bacteria | 3867 |
| 21 | Ga0466708_413416 | 3300042652 | Bacteria | 7603 |
| 22 | Ga0123355_10044171 | 3300009826 | Bacteria | 7252 |
| 23 | Ga0123356_10707193 | 3300010049 | Bacteria | 1177 |
| 24 | Ga0466700_361462 | 3300042600 | Bacteria | 1150 |
| 25 | Ga0466720_020438 | 3300042607 | Bacteria | 42880 |
| 26 | Ga0466720_040510 | 3300042607 | Bacteria | 114340 |
| 27 | Ga0466722_170979 | 3300042609 | Bacteria | 6400 |
| 28 | JGI24698J34947_10004258 | 3300002449 | Bacteria | 7784 |
| 29 | JGI24698J34947_10011007 | 3300002449 | Bacteria | 4963 |
| 30 | JGI24698J34947_10030389 | 3300002449 | Bacteria | 2849 |
| 31 | Ga0072941_1044093 | 3300005201 | Bacteria | 1963 |
| 32 | Ga0466712_298842 | 3300042614 | Unclassified | 5154 |
| 33 | Ga0466711_012004 | 3300042615 | Bacteria | 25076 |
| 34 | Ga0466711_360410 | 3300042615 | Bacteria | 21261 |
| 35 | Ga0466715_023613 | 3300042616 | Bacteria | 6963 |
| 36 | Ga0466691_222404 | 3300042593 | Bacteria | 8657 |
| 37 | Ga0466694_025623 | 3300042594 | Bacteria | 1841 |
| 38 | Ga0466699_058701 | 3300042597 | Bacteria | 19486 |
| 39 | Ga0466731_302024 | 3300042622 | Bacteria | 1290 |
| 40 | Ga0466735_188612 | 3300042624 | Bacteria | 1207 |
| 41 | Ga0466703_182243 | 3300042636 | Bacteria | 9260 |
| 42 | Ga0466704_568501 | 3300042643 | Bacteria | 4107 |
| 43 | Ga0466724_34506 | 3300042649 | Bacteria | 1342 |
| 44 | Ga0466708_164685 | 3300042652 | Bacteria | 38582 |
| 45 | Ga0466727_298886 | 3300042655 | Bacteria | 1924 |
| 46 | Ga0123357_10318175 | 3300009784 | Bacteria | 1542 |
| 47 | Ga0123355_10015415 | 3300009826 | Bacteria | 12006 |
| 48 | Ga0123356_10232882 | 3300010049 | Bacteria | 1907 |
| 49 | Ga0123354_10079176 | 3300010882 | Bacteria | 4665 |
| 50 | Ga0123354_10108840 | 3300010882 | Bacteria | 3677 |
| 51 | Ga0123354_10214671 | 3300010882 | Bacteria | 2066 |
| 52 | Ga0466716_041242 | 3300042605 | Bacteria | 7214 |
| 53 | Ga0466722_017544 | 3300042609 | Bacteria | 13508 |
| 54 | JGI24698J34947_10003241 | 3300002449 | Bacteria | 8817 |
| 55 | JGI24702J35022_10024144 | 3300002462 | Bacteria | 3284 |
| 56 | Ga0123357_10000078 | 3300009784 | Bacteria | 77439 |
| 57 | Ga0466705_189919 | 3300042612 | Bacteria | 11596 |
| 58 | Ga0466705_317549 | 3300042612 | Bacteria | 1376 |
| 59 | Ga0466726_212427 | 3300042619 | Bacteria | 1719 |
| 60 | Ga0466726_436949 | 3300042619 | Bacteria | 1068 |
| 61 | Ga0466690_040531 | 3300042590 | Bacteria | 13360 |
| 62 | Ga0466694_044986 | 3300042594 | Bacteria | 11669 |
| 63 | Ga0466696_052816 | 3300042596 | Bacteria | 11128 |
| 64 | Ga0466699_149781 | 3300042597 | Bacteria | 1219 |
| 65 | Ga0466699_231520 | 3300042597 | Bacteria | 8551 |
| 66 | Ga0466699_385238 | 3300042597 | Bacteria | 2378 |
| 67 | Ga0466702_339009 | 3300042635 | Bacteria | 8822 |
| 68 | Ga0466703_134965 | 3300042636 | Bacteria | 5149 |
| 69 | Ga0466704_162848 | 3300042643 | Bacteria | 3743 |
| 70 | Ga0466704_197813 | 3300042643 | Bacteria | 3581 |
| 71 | Ga0466704_436412 | 3300042643 | Bacteria | 1782 |
| 72 | Ga0466709_257471 | 3300042648 | Bacteria | 5027 |
| 73 | Ga0466708_011315 | 3300042652 | Bacteria | 5883 |
| 74 | Ga0466708_076486 | 3300042652 | Bacteria | 13011 |
| 75 | Ga0466708_347963 | 3300042652 | Unclassified | 3070 |
| 76 | Ga0466727_079383 | 3300042655 | Bacteria | 1760 |
| 77 | Ga0123357_10311187 | 3300009784 | Bacteria | 1572 |
| 78 | Ga0123357_10363931 | 3300009784 | Bacteria | 1365 |
| 79 | Ga0123356_10154218 | 3300010049 | Bacteria | 2285 |
| 80 | Ga0466716_218433 | 3300042605 | Unclassified | 1194 |
| 81 | Ga0466720_090299 | 3300042607 | Bacteria | 13654 |
| 82 | Ga0466721_061420 | 3300042608 | Bacteria | 1288 |
| 83 | Ga0466722_132264 | 3300042609 | Bacteria | 6129 |
| 84 | Ga0466698_372926 | 3300042610 | Bacteria | 1313 |
| 85 | JGI24698J34947_10000770 | 3300002449 | Unclassified | 15890 |
| 86 | JGI24698J34947_10032806 | 3300002449 | Unclassified | 2725 |
| 87 | JGI24695J34938_10004328 | 3300002450 | Bacteria | 9353 |
| 88 | Ga0466733_027104 | 3300042659 | Bacteria | 2204 |
| 89 | Ga0466711_057955 | 3300042615 | Bacteria | 4661 |
| 90 | Ga0466718_128036 | 3300042617 | Bacteria | 29323 |
| 91 | Ga0466723_308520 | 3300042618 | Bacteria | 3810 |
| 92 | Ga0466694_232941 | 3300042594 | Bacteria | 22254 |
| 93 | Ga0466696_004779 | 3300042596 | Bacteria | 1717 |
| 94 | Ga0466696_067549 | 3300042596 | Bacteria | 1872 |
| 95 | Ga0466699_208082 | 3300042597 | Bacteria | 2379 |
| 96 | Ga0466735_070179 | 3300042624 | Bacteria | 12067 |
| 97 | Ga0466703_178109 | 3300042636 | Bacteria | 4010 |
| 98 | Ga0466704_366023 | 3300042643 | Bacteria | 2302 |
| 99 | Ga0466704_381079 | 3300042643 | Bacteria | 1776 |
| 100 | Ga0123356_10075712 | 3300010049 | Bacteria | 3170 |
| 101 | Ga0123356_10287262 | 3300010049 | Bacteria | 1743 |
| 102 | Ga0123356_11047310 | 3300010049 | Unclassified | 985 |
| 103 | Ga0123353_10123910 | 3300010167 | Bacteria | 4154 |
| 104 | Ga0123353_10811697 | 3300010167 | Bacteria | 1290 |
| 105 | Ga0466719_092443 | 3300042606 | Bacteria | 19032 |
| 106 | Ga0466719_316535 | 3300042606 | Bacteria | 3984 |
| 107 | Ga0466698_407258 | 3300042610 | Bacteria | 1537 |
| 108 | JGI24698J34947_10000878 | 3300002449 | Bacteria | 15193 |
| 109 | JGI24698J34947_10114100 | 3300002449 | Bacteria | 1186 |
| 110 | Ga0072940_1045226 | 3300005200 | Bacteria | 1529 |
| 111 | Ga0072941_1027055 | 3300005201 | Bacteria | 6803 |
| 112 | Ga0466705_225373 | 3300042612 | Bacteria | 1872 |
| 113 | Ga0466727_349961 | 3300042655 | Unclassified | 1516 |
| 114 | Ga0466718_092209 | 3300042617 | Bacteria | 73198 |
| 115 | Ga0466728_173335 | 3300042620 | Bacteria | 3362 |
| 116 | Ga0264413_134638 | 3300024493 | Bacteria | 4338 |
| 117 | Ga0415639_084053 | 3300038395 | Bacteria | 2831 |
| 118 | Ga0456237_0005329 | 3300041968 | Bacteria | 2042 |
| 119 | Ga0466691_220219 | 3300042593 | Bacteria | 11339 |
| 120 | Ga0466694_377160 | 3300042594 | Unclassified | 1343 |
| 121 | Ga0466696_094655 | 3300042596 | Bacteria | 11377 |
| 122 | Ga0466696_243029 | 3300042596 | Bacteria | 2891 |
| 123 | Ga0466699_425784 | 3300042597 | Bacteria | 1568 |
| 124 | Ga0466709_146861 | 3300042648 | Bacteria | 3680 |
| 125 | Ga0466709_206953 | 3300042648 | Bacteria | 6666 |
| 126 | Ga0466708_237596 | 3300042652 | Unclassified | 5037 |
| 127 | Ga0466727_089900 | 3300042655 | Bacteria | 3625 |
| 128 | Ga0123355_10239986 | 3300009826 | Bacteria | 2570 |
| 129 | Ga0123356_10013106 | 3300010049 | Bacteria | 8017 |
| 130 | Ga0123356_10080078 | 3300010049 | Bacteria | 3087 |
| 131 | Ga0123356_10152470 | 3300010049 | Bacteria | 2296 |
| 132 | Ga0123353_10759882 | 3300010167 | Bacteria | 1347 |
| 133 | Ga0466716_132913 | 3300042605 | Bacteria | 1739 |
| 134 | Ga0466716_267549 | 3300042605 | Bacteria | 2044 |
| 135 | JGI24698J34947_10007368 | 3300002449 | Bacteria | 6049 |
| 136 | JGI24698J34947_10021698 | 3300002449 | Unclassified | 3450 |
| 137 | JGI24705J35276_12082642 | 3300002504 | Bacteria | 977 |
| 138 | Ga0072940_1057857 | 3300005200 | Bacteria | 2247 |
| 139 | Ga0466705_026099 | 3300042612 | Bacteria | 14603 |
| 140 | Ga0466732_457188 | 3300042656 | Bacteria | 2685 |
| 141 | Ga0466712_076648 | 3300042614 | Bacteria | 31023 |
| 142 | Ga0466712_166630 | 3300042614 | Bacteria | 4858 |
| 143 | Ga0466715_235089 | 3300042616 | Bacteria | 1704 |
| 144 | Ga0466723_343537 | 3300042618 | Bacteria | 96271 |
| 145 | Ga0466726_241896 | 3300042619 | Bacteria | 5754 |
| 146 | Ga0466728_230008 | 3300042620 | Bacteria | 5536 |
| 147 | Ga0466729_124166 | 3300042621 | Bacteria | 1535 |
| 148 | Ga0466690_114791 | 3300042590 | Bacteria | 1306 |
| 149 | Ga0466691_025424 | 3300042593 | Bacteria | 9668 |
| 150 | Ga0466694_317939 | 3300042594 | Bacteria | 1288 |
| 151 | Ga0466696_083424 | 3300042596 | Bacteria | 12507 |
| 152 | Ga0466699_214093 | 3300042597 | Bacteria | 2199 |
| 153 | Ga0466703_041270 | 3300042636 | Bacteria | 17976 |
| 154 | Ga0466708_107152 | 3300042652 | Bacteria | 1773 |
| 155 | Ga0466727_208900 | 3300042655 | Bacteria | 2053 |
| 156 | Ga0466727_218699 | 3300042655 | Bacteria | 2953 |
| 157 | Ga0123356_10012309 | 3300010049 | Bacteria | 8308 |
| 158 | Ga0123356_10035627 | 3300010049 | Bacteria | 4648 |
| 159 | Ga0123356_10035847 | 3300010049 | Bacteria | 4631 |
| 160 | Ga0123356_10155139 | 3300010049 | Bacteria | 2279 |
| 161 | Ga0123356_10308854 | 3300010049 | Bacteria | 1690 |
| 162 | Ga0123356_10667982 | 3300010049 | Bacteria | 1207 |
| 163 | Ga0123353_10529556 | 3300010167 | Bacteria | 1706 |
| 164 | Ga0466700_189443 | 3300042600 | Bacteria | 1730 |
| 165 | Ga0466716_044962 | 3300042605 | Bacteria | 1686 |
| 166 | Ga0466719_043527 | 3300042606 | Bacteria | 2101 |
| 167 | Ga0466720_206605 | 3300042607 | Bacteria | 1188 |
| 168 | Ga0466721_036157 | 3300042608 | Bacteria | 12431 |
| 169 | JGI24699J35502_11030571 | 3300002509 | Bacteria | 1508 |
| 170 | Ga0466712_040576 | 3300042614 | Bacteria | 5337 |
| 171 | Ga0466718_158917 | 3300042617 | Bacteria | 12870 |
| 172 | Ga0466723_200735 | 3300042618 | Bacteria | 5814 |
| 173 | Ga0415639_010465 | 3300038395 | Bacteria | 26849 |
| 174 | Ga0466690_288196 | 3300042590 | Bacteria | 3243 |
| 175 | Ga0466692_181579 | 3300042591 | Bacteria | 2473 |
| 176 | Ga0466693_047574 | 3300042592 | Bacteria | 9083 |
| 177 | Ga0466696_017224 | 3300042596 | Bacteria | 5485 |
| 178 | Ga0466729_278259 | 3300042621 | Bacteria | 1018 |
| 179 | Ga0466704_356334 | 3300042643 | Bacteria | 58812 |
| 180 | Ga0466704_401020 | 3300042643 | Unclassified | 4238 |
| 181 | Ga0466709_136945 | 3300042648 | Bacteria | 18039 |
| 182 | Ga0466727_215974 | 3300042655 | Bacteria | 1290 |
| 183 | Ga0466727_325083 | 3300042655 | Bacteria | 1510 |
| 184 | Ga0123356_10277916 | 3300010049 | Bacteria | 1768 |
| 185 | Ga0123356_10803615 | 3300010049 | Bacteria | 1111 |
| 186 | Ga0123353_10507124 | 3300010167 | Bacteria | 1755 |
| 187 | Ga0123354_10116094 | 3300010882 | Bacteria | 3494 |
| 188 | Ga0466707_367448 | 3300042601 | Bacteria | 1217 |
| 189 | AustNasuHG_c1001156 | 3300000089 | Bacteria | 9471 |
| 190 | JGI24698J34947_10006304 | 3300002449 | Bacteria | 6518 |
| 191 | JGI24695J34938_10001452 | 3300002450 | Bacteria | 20065 |
| 192 | JGI24695J34938_10001877 | 3300002450 | Bacteria | 17078 |
| 193 | JGI24695J34938_10018072 | 3300002450 | Bacteria | 3536 |
| 194 | JGI24702J35022_10014499 | 3300002462 | Bacteria | 4349 |
| 195 | JGI24702J35022_10031396 | 3300002462 | Bacteria | 2847 |
| 196 | Ga0072941_1019076 | 3300005201 | Bacteria | 8553 |
| 197 | Ga0466732_141017 | 3300042656 | Bacteria | 19839 |
| 198 | Ga0466712_005718 | 3300042614 | Bacteria | 27508 |
| 199 | Ga0466712_062613 | 3300042614 | Unclassified | 21510 |
| 200 | Ga0466712_256465 | 3300042614 | Bacteria | 12566 |
| 201 | Ga0466712_315302 | 3300042614 | Unclassified | 2132 |
| 202 | Ga0466711_471644 | 3300042615 | Bacteria | 39662 |
| 203 | Ga0466715_031768 | 3300042616 | Unclassified | 3286 |
| 204 | Ga0466723_015872 | 3300042618 | Bacteria | 6580 |
| 205 | Ga0466723_312704 | 3300042618 | Unclassified | 3922 |
| 206 | Ga0466723_340241 | 3300042618 | Bacteria | 1306 |
| 207 | Ga0466726_425104 | 3300042619 | Bacteria | 1844 |
| 208 | Ga0466726_450684 | 3300042619 | Bacteria | 1916 |
| 209 | Ga0466728_231017 | 3300042620 | Bacteria | 2693 |
| 210 | Ga0466699_105053 | 3300042597 | Bacteria | 2204 |
| 211 | Ga0466699_265963 | 3300042597 | Bacteria | 1599 |
| 212 | Ga0466699_365840 | 3300042597 | Bacteria | 2461 |
| 213 | Ga0466703_064325 | 3300042636 | Unclassified | 1604 |
| 214 | Ga0466703_413343 | 3300042636 | Bacteria | 68476 |
| 215 | Ga0466708_032854 | 3300042652 | Bacteria | 3430 |
| 216 | Ga0466727_093449 | 3300042655 | Bacteria | 2193 |
| 217 | Ga0123357_10096653 | 3300009784 | Bacteria | 3825 |
| 218 | Ga0123357_10254581 | 3300009784 | Unclassified | 1870 |
| 219 | Ga0123356_10233069 | 3300010049 | Bacteria | 1906 |
| 220 | Ga0466700_285403 | 3300042600 | Bacteria | 1447 |
| 221 | Ga0466707_295728 | 3300042601 | Bacteria | 2814 |
| 222 | Ga0466719_038286 | 3300042606 | Bacteria | 26153 |
| 223 | Ga0466719_485584 | 3300042606 | Bacteria | 4353 |
| 224 | JGI24698J34947_10005295 | 3300002449 | Bacteria | 7078 |
| 225 | JGI24698J34947_10044627 | 3300002449 | Unclassified | 2267 |
| 226 | JGI24698J34947_10061185 | 3300002449 | Bacteria | 1854 |
| 227 | JGI24698J34947_10073618 | 3300002449 | Unclassified | 1630 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF01261 | AP_endonuc_2 | Xylose isomerase-like TIM barrel | 70 | 317 | 0.84 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.