Protein Family IF10234
Metagenome
Isolate
122
Members
41
Samples
115
Scaffolds
569.61
Avg Length
Representative Sequence
- ID
- 3300042656|Ga0466732_099901|Ga0466732_099901_1270_3156
- Length
- 605 aa
- Sequence
- MIEELSVRNFALIDSLNISFEKGFTVLSGETGAGKSIIVGSLGFLFGAKTDGEIIRSGSEEASVSAVVSIDGKNRDALQWLSQREIEQEDSRLVIRRSVKASGRNSIYIQNVPVTRNDLAEFTGFLFDLHGQHNHESLLRKETHRVYLDRFSGLEDEVAAFSRVFTELAEKRKTLEALNRSEKEREQRLEILNYAIEEITKADPKNGEIKELEAETQRLADFEKLSLHVNSVSSLLFEDSESRDSEVSFLSLARRLRASIENAASIDSSLSPMLKRLEDIYYEAEDLAAEFRNYRGRLSYDPAKLEEAEERLALLYKLKKKYRPACLPDSSGANSEAKSQLYKAEAXXXIEALSGAGENQDRIKAEITRLEKDIAARASVLSAKRNEGAKRLGEGITSILSRLGMPRAVFAASVKPKTMEGGAGLVCGPFGADDVEFMISANKGEPLKELARIASGGELSRVMLAIKTILLDSNGVAAGRASASDGSPQETLIFDEIDTGIGGEVALSVGEYLARIGKGKQIFCVTHLASIAVRADNHLKVEKKVIASGGGAGERTVTLVSQLKGAERRQEIARMLAGDSGKVALAHADELLAKYSVVKNGESNK
Sample Types
Isolate
5.7%
Metagenome
94.3%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
34.1%
Kalotermitidae
34.1%
Unclassified
19.5%
Termopsidae
7.3%
Rhinotermitidae
4.9%
Taxonomy
Archaea
0
Bacteria
118
Eukaryota
0
Viruses
0
Unclassified
4
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2781125694 | Treponema sp. Th196P3bin120 | Isolate | Unclassified |
| 2 | 2781125697 | Treponema sp. Th196P4bin17 | Isolate | Unclassified |
| 3 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 4 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 5 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 6 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 7 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 8 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 9 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 10 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 11 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 12 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 13 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 14 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 15 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 16 | 2781125653 | Treponema sp. Emb289P1bin107 | Isolate | Unclassified |
| 17 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 18 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 19 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 20 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 21 | 3300005485 | Termite gut microbial communities from Costa Rica - P3 luminal contents | Metagenome | Termitidae |
| 22 | 650716099 | Leadbettera azotonutricia ZAS-9 | Isolate | Unclassified |
| 23 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 24 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 25 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 26 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 27 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 28 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 29 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 30 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 31 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 32 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 33 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 34 | 2781125681 | Treponema sp. Lab288P1bin11 | Isolate | Unclassified |
| 35 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 36 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 37 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 38 | 2781125632 | Treponema sp. Co191P1bin87 | Isolate | Unclassified |
| 39 | 2781125655 | Treponema sp. Emb289P1bin105 | Isolate | Unclassified |
| 40 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 41 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_018226 | 3300042612 | Bacteria | 5482 |
| 2 | Ga0466705_364070 | 3300042612 | Bacteria | 8529 |
| 3 | Ga0466733_047748 | 3300042659 | Bacteria | 18818 |
| 4 | Ga0466733_057319 | 3300042659 | Bacteria | 6207 |
| 5 | Ga0466733_061320 | 3300042659 | Bacteria | 23618 |
| 6 | JGI24698J34947_10001087 | 3300002449 | Bacteria | 14019 |
| 7 | JGI24702J35022_10003053 | 3300002462 | Bacteria | 10121 |
| 8 | JGI24702J35022_10003935 | 3300002462 | Bacteria | 8924 |
| 9 | Ga0466712_009637 | 3300042614 | Bacteria | 6774 |
| 10 | Ga0466715_067483 | 3300042616 | Bacteria | 42347 |
| 11 | Ga0466715_296128 | 3300042616 | Bacteria | 9376 |
| 12 | Ga0466723_035052 | 3300042618 | Bacteria | 2914 |
| 13 | Ga0466723_124748 | 3300042618 | Bacteria | 48807 |
| 14 | Ga0466728_325652 | 3300042620 | Bacteria | 12443 |
| 15 | Ga0466703_008974 | 3300042636 | Bacteria | 24043 |
| 16 | Ga0466703_118360 | 3300042636 | Bacteria | 9117 |
| 17 | Ga0466703_339548 | 3300042636 | Bacteria | 12089 |
| 18 | Ga0466705_024380 | 3300042612 | Bacteria | 10141 |
| 19 | JGI24698J34947_10003416 | 3300002449 | Bacteria | 8618 |
| 20 | Ga0466691_009800 | 3300042593 | Bacteria | 6571 |
| 21 | Ga0466694_116198 | 3300042594 | Bacteria | 13971 |
| 22 | Ga0466696_182880 | 3300042596 | Bacteria | 6456 |
| 23 | Ga0123353_10001645 | 3300010167 | Bacteria | 27507 |
| 24 | Ga0123353_10319779 | 3300010167 | Bacteria | 2356 |
| 25 | Ga0466711_452100 | 3300042615 | Bacteria | 15067 |
| 26 | Ga0466715_118473 | 3300042616 | Bacteria | 11378 |
| 27 | Ga0466715_536102 | 3300042616 | Bacteria | 9488 |
| 28 | Ga0466715_549980 | 3300042616 | Bacteria | 16549 |
| 29 | Ga0466723_135869 | 3300042618 | Bacteria | 11379 |
| 30 | Ga0466726_153903 | 3300042619 | Bacteria | 8761 |
| 31 | Ga0466719_007851 | 3300042606 | Bacteria | 7496 |
| 32 | Ga0466719_016801 | 3300042606 | Bacteria | 34227 |
| 33 | Ga0466704_090497 | 3300042643 | Bacteria | 11716 |
| 34 | Ga0466708_364014 | 3300042652 | Bacteria | 9931 |
| 35 | Ga0466732_099901 | 3300042656 | Bacteria | 5146 |
| 36 | Ga0466733_102077 | 3300042659 | Bacteria | 2117 |
| 37 | JGI24702J35022_10004781 | 3300002462 | Bacteria | 8004 |
| 38 | Ga0074263_107373 | 3300005485 | Bacteria | 3720 |
| 39 | Ga0466690_368980 | 3300042590 | Unclassified | 4700 |
| 40 | Ga0466696_149909 | 3300042596 | Bacteria | 2643 |
| 41 | Ga0466712_053813 | 3300042614 | Bacteria | 17032 |
| 42 | Ga0466711_164377 | 3300042615 | Bacteria | 13533 |
| 43 | Ga0466726_256636 | 3300042619 | Bacteria | 5022 |
| 44 | Ga0466707_218761 | 3300042601 | Bacteria | 5973 |
| 45 | Ga0466719_464750 | 3300042606 | Bacteria | 5564 |
| 46 | Ga0466703_043864 | 3300042636 | Bacteria | 9104 |
| 47 | Ga0466704_342680 | 3300042643 | Unclassified | 9772 |
| 48 | Ga0466709_393295 | 3300042648 | Bacteria | 11437 |
| 49 | Ga0466705_211889 | 3300042612 | Bacteria | 9256 |
| 50 | JGI24698J34947_10006831 | 3300002449 | Unclassified | 6270 |
| 51 | JGI24698J34947_10016551 | 3300002449 | Bacteria | 3999 |
| 52 | Ga0068302_10191136 | 3300005071 | Bacteria | 2121 |
| 53 | Ga0466693_320956 | 3300042592 | Bacteria | 9680 |
| 54 | Ga0466715_083864 | 3300042616 | Bacteria | 9437 |
| 55 | Ga0466715_212868 | 3300042616 | Bacteria | 5617 |
| 56 | Ga0466728_209244 | 3300042620 | Bacteria | 5375 |
| 57 | Ga0466722_054557 | 3300042609 | Bacteria | 16684 |
| 58 | Ga0466729_214176 | 3300042621 | Bacteria | 3453 |
| 59 | Ga0466703_324914 | 3300042636 | Bacteria | 15390 |
| 60 | Ga0466704_102735 | 3300042643 | Bacteria | 6816 |
| 61 | Ga0466704_245588 | 3300042643 | Bacteria | 25369 |
| 62 | Ga0466705_238865 | 3300042612 | Bacteria | 7111 |
| 63 | JGI24702J35022_10023523 | 3300002462 | Bacteria | 3331 |
| 64 | Ga0466691_179250 | 3300042593 | Bacteria | 50171 |
| 65 | Ga0123355_10001603 | 3300009826 | Bacteria | 31578 |
| 66 | Ga0466705_425764 | 3300042612 | Bacteria | 5386 |
| 67 | Ga0466712_055475 | 3300042614 | Bacteria | 18108 |
| 68 | Ga0466715_002053 | 3300042616 | Bacteria | 10028 |
| 69 | Ga0466728_158858 | 3300042620 | Bacteria | 3710 |
| 70 | Ga0466707_156282 | 3300042601 | Bacteria | 2765 |
| 71 | Ga0466716_466421 | 3300042605 | Bacteria | 7929 |
| 72 | Ga0466719_412693 | 3300042606 | Bacteria | 14978 |
| 73 | Ga0466703_359189 | 3300042636 | Bacteria | 7606 |
| 74 | Ga0466703_367991 | 3300042636 | Bacteria | 5692 |
| 75 | Ga0466708_114772 | 3300042652 | Bacteria | 5434 |
| 76 | Ga0466708_319097 | 3300042652 | Bacteria | 10816 |
| 77 | Ga0466705_213507 | 3300042612 | Bacteria | 9449 |
| 78 | AustNasuHG_c1000529 | 3300000089 | Bacteria | 13393 |
| 79 | JGI24698J34947_10006705 | 3300002449 | Bacteria | 6323 |
| 80 | Ga0466690_183771 | 3300042590 | Bacteria | 29648 |
| 81 | Ga0466691_115982 | 3300042593 | Bacteria | 8897 |
| 82 | Ga0466694_035606 | 3300042594 | Bacteria | 9819 |
| 83 | Ga0466695_361079 | 3300042595 | Bacteria | 5673 |
| 84 | Ga0466696_012443 | 3300042596 | Bacteria | 22314 |
| 85 | Ga0123355_10068730 | 3300009826 | Bacteria | 5698 |
| 86 | Ga0466711_369740 | 3300042615 | Bacteria | 8357 |
| 87 | Ga0466711_382714 | 3300042615 | Bacteria | 15087 |
| 88 | Ga0466723_353581 | 3300042618 | Bacteria | 33076 |
| 89 | Ga0466716_068534 | 3300042605 | Bacteria | 10766 |
| 90 | Ga0466722_225630 | 3300042609 | Bacteria | 14425 |
| 91 | Ga0466704_026495 | 3300042643 | Bacteria | 14073 |
| 92 | Ga0466704_495401 | 3300042643 | Bacteria | 8891 |
| 93 | Ga0466705_142381 | 3300042612 | Bacteria | 9736 |
| 94 | JGI24698J34947_10044003 | 3300002449 | Bacteria | 2287 |
| 95 | Ga0466696_045022 | 3300042596 | Bacteria | 11465 |
| 96 | Ga0466712_030303 | 3300042614 | Bacteria | 13320 |
| 97 | Ga0466712_109130 | 3300042614 | Bacteria | 13922 |
| 98 | Ga0466715_164223 | 3300042616 | Bacteria | 8240 |
| 99 | Ga0466723_249196 | 3300042618 | Bacteria | 8057 |
| 100 | Ga0466716_384984 | 3300042605 | Bacteria | 16511 |
| 101 | Ga0466719_053243 | 3300042606 | Bacteria | 17590 |
| 102 | Ga0466719_071256 | 3300042606 | Bacteria | 12912 |
| 103 | Ga0466704_068557 | 3300042643 | Bacteria | 4524 |
| 104 | Ga0466704_509175 | 3300042643 | Bacteria | 22628 |
| 105 | Ga0466708_369009 | 3300042652 | Bacteria | 6859 |
| 106 | Ga0466733_152794 | 3300042659 | Bacteria | 22235 |
| 107 | JGI24702J35022_10006864 | 3300002462 | Bacteria | 6555 |
| 108 | Ga0415639_092158 | 3300038395 | Bacteria | 3701 |
| 109 | Ga0123353_10008059 | 3300010167 | Bacteria | 14334 |
| 110 | Ga0466705_478818 | 3300042612 | Bacteria | 2685 |
| 111 | Ga0466718_159405 | 3300042617 | Bacteria | 6433 |
| 112 | Ga0466723_009351 | 3300042618 | Bacteria | 5637 |
| 113 | Ga0466723_154064 | 3300042618 | Unclassified | 27270 |
| 114 | Ga0466735_118916 | 3300042624 | Bacteria | 2456 |
| 115 | Ga0466704_175595 | 3300042643 | Bacteria | 5912 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.