Protein Family IF10217
Metagenome
Isolate
146
Members
54
Samples
139
Scaffolds
153.44
Avg Length
Representative Sequence
- ID
- 3300042656|Ga0466732_002206|Ga0466732_002206_183_653
- Length
- 156 aa
- Sequence
- MNNLNSILIEGNLVKDPLLRSTPKGTPVCTMTLASNRFCKQETGSGFERKVSYFDVESWAKLAEACYSQGHKGRGVRVVGRLKQDRWNDTEGKIHSRVTIVAEHVEFRPEFKKDEFAKSAVAEAGFAHGEPGNPDSPSSEDAPVTMKEEELEPVAF
Sample Types
Isolate
4.8%
Metagenome
95.2%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
48.1%
Kalotermitidae
25.9%
Unclassified
14.8%
Rhinotermitidae
5.6%
Termopsidae
3.7%
Hodotermitidae
1.9%
Taxonomy
Archaea
0
Bacteria
139
Eukaryota
0
Viruses
0
Unclassified
7
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2781125639 | Treponema sp. Co191P1bin44 | Isolate | Unclassified |
| 2 | 3300002507 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P1 | Metagenome | Termitidae |
| 3 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 4 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 5 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 6 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 7 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 8 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 9 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 10 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 11 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 12 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 13 | 2781125646 | Treponema sp. Co191P3bin59 | Isolate | Unclassified |
| 14 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 15 | 2781125632 | Treponema sp. Co191P1bin87 | Isolate | Unclassified |
| 16 | 2781125636 | Treponema sp. Co191P1bin67 | Isolate | Unclassified |
| 17 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 18 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 19 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 20 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 21 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 22 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 23 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 24 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 25 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 26 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 27 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 28 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 29 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 30 | 2781125690 | Treponema sp. Th196P3bin63 | Isolate | Unclassified |
| 31 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 32 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 33 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 34 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 35 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 36 | 2781125697 | Treponema sp. Th196P4bin17 | Isolate | Unclassified |
| 37 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 38 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 39 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 40 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 41 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 42 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 43 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 44 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 45 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 46 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 47 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 48 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 49 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 50 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 51 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 52 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 53 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 54 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466733_141686 | 3300042659 | Bacteria | 12353 |
| 2 | Ga0466733_174585 | 3300042659 | Bacteria | 9441 |
| 3 | Ga0466692_071881 | 3300042591 | Bacteria | 1430 |
| 4 | Ga0466692_191803 | 3300042591 | Bacteria | 1386 |
| 5 | Ga0466694_023101 | 3300042594 | Bacteria | 2224 |
| 6 | Ga0466694_174349 | 3300042594 | Bacteria | 93398 |
| 7 | Ga0466696_258401 | 3300042596 | Bacteria | 27265 |
| 8 | Ga0466699_005199 | 3300042597 | Bacteria | 2541 |
| 9 | Ga0466717_208057 | 3300042604 | Bacteria | 1068 |
| 10 | Ga0123355_10429007 | 3300009826 | Bacteria | 1683 |
| 11 | JGI24695J34938_10000639 | 3300002450 | Bacteria | 33425 |
| 12 | Ga0072940_1029207 | 3300005200 | Bacteria | 10311 |
| 13 | Ga0466709_265324 | 3300042648 | Unclassified | 1851 |
| 14 | Ga0466727_032965 | 3300042655 | Bacteria | 22745 |
| 15 | Ga0466726_165610 | 3300042619 | Bacteria | 8632 |
| 16 | Ga0466732_453982 | 3300042656 | Unclassified | 1897 |
| 17 | Ga0466690_430916 | 3300042590 | Bacteria | 3420 |
| 18 | Ga0466694_205258 | 3300042594 | Bacteria | 9330 |
| 19 | Ga0466706_260803 | 3300042599 | Bacteria | 1344 |
| 20 | Ga0466719_217336 | 3300042606 | Bacteria | 3019 |
| 21 | Ga0466720_038655 | 3300042607 | Bacteria | 16892 |
| 22 | Ga0466722_245350 | 3300042609 | Bacteria | 5930 |
| 23 | Ga0123356_10301421 | 3300010049 | Bacteria | 1708 |
| 24 | JGI24695J34938_10005826 | 3300002450 | Bacteria | 7579 |
| 25 | JGI24702J35022_10042966 | 3300002462 | Bacteria | 2406 |
| 26 | Ga0068305_10136142 | 3300005083 | Bacteria | 621 |
| 27 | Ga0466705_135722 | 3300042612 | Bacteria | 10677 |
| 28 | Ga0466703_174657 | 3300042636 | Bacteria | 2467 |
| 29 | Ga0466703_253100 | 3300042636 | Bacteria | 3412 |
| 30 | Ga0466704_347662 | 3300042643 | Bacteria | 4515 |
| 31 | Ga0466708_068034 | 3300042652 | Bacteria | 1083 |
| 32 | Ga0466708_247106 | 3300042652 | Bacteria | 17278 |
| 33 | Ga0466727_169019 | 3300042655 | Bacteria | 1663 |
| 34 | Ga0466712_068324 | 3300042614 | Unclassified | 6096 |
| 35 | Ga0466712_175354 | 3300042614 | Bacteria | 1322 |
| 36 | Ga0466723_156051 | 3300042618 | Bacteria | 7975 |
| 37 | Ga0466692_176686 | 3300042591 | Bacteria | 4140 |
| 38 | Ga0466699_107554 | 3300042597 | Bacteria | 27463 |
| 39 | Ga0466717_024627 | 3300042604 | Bacteria | 1904 |
| 40 | Ga0123356_10005138 | 3300010049 | Bacteria | 13409 |
| 41 | Ga0123356_10066155 | 3300010049 | Bacteria | 3383 |
| 42 | Ga0123356_11927805 | 3300010049 | Bacteria | 736 |
| 43 | Ga0123353_11350673 | 3300010167 | Bacteria | 921 |
| 44 | Ga0123354_10713054 | 3300010882 | Bacteria | 697 |
| 45 | JGI24698J34947_10112619 | 3300002449 | Bacteria | 1198 |
| 46 | JGI24698J34947_10119476 | 3300002449 | Bacteria | 1147 |
| 47 | JGI24698J34947_10122186 | 3300002449 | Bacteria | 1128 |
| 48 | JGI24695J34938_10012039 | 3300002450 | Bacteria | 4611 |
| 49 | Ga0072940_1027775 | 3300005200 | Bacteria | 3020 |
| 50 | Ga0466705_130691 | 3300042612 | Bacteria | 11181 |
| 51 | Ga0466731_387983 | 3300042622 | Bacteria | 4830 |
| 52 | Ga0466704_210782 | 3300042643 | Bacteria | 5030 |
| 53 | Ga0466727_274973 | 3300042655 | Bacteria | 1404 |
| 54 | Ga0466712_015489 | 3300042614 | Bacteria | 11417 |
| 55 | Ga0466712_116656 | 3300042614 | Bacteria | 1146 |
| 56 | Ga0466723_261690 | 3300042618 | Bacteria | 4021 |
| 57 | Ga0466690_321497 | 3300042590 | Bacteria | 11781 |
| 58 | Ga0466694_158201 | 3300042594 | Bacteria | 1617 |
| 59 | Ga0466716_186170 | 3300042605 | Bacteria | 8174 |
| 60 | Ga0123353_11270166 | 3300010167 | Bacteria | 959 |
| 61 | AustNasuHG_c1003297 | 3300000089 | Bacteria | 5827 |
| 62 | JGI24698J34947_10013936 | 3300002449 | Unclassified | 4382 |
| 63 | JGI24698J34947_10020358 | 3300002449 | Bacteria | 3573 |
| 64 | JGI24695J34938_10051151 | 3300002450 | Bacteria | 1809 |
| 65 | JGI24697J35500_11225756 | 3300002507 | Bacteria | 1953 |
| 66 | Ga0072940_1027729 | 3300005200 | Bacteria | 3192 |
| 67 | Ga0466703_010528 | 3300042636 | Bacteria | 12005 |
| 68 | Ga0466703_174540 | 3300042636 | Bacteria | 45225 |
| 69 | Ga0466709_035429 | 3300042648 | Bacteria | 8310 |
| 70 | Ga0466708_211953 | 3300042652 | Bacteria | 3903 |
| 71 | Ga0466712_150914 | 3300042614 | Bacteria | 1199 |
| 72 | Ga0466711_183740 | 3300042615 | Bacteria | 2025 |
| 73 | Ga0466711_250165 | 3300042615 | Bacteria | 77191 |
| 74 | Ga0466715_074250 | 3300042616 | Bacteria | 7207 |
| 75 | Ga0466715_097861 | 3300042616 | Bacteria | 28870 |
| 76 | Ga0466718_097649 | 3300042617 | Bacteria | 3016 |
| 77 | Ga0466732_002206 | 3300042656 | Bacteria | 1155 |
| 78 | Ga0415639_005708 | 3300038395 | Bacteria | 3278 |
| 79 | Ga0466722_064163 | 3300042609 | Bacteria | 5166 |
| 80 | Ga0466722_066439 | 3300042609 | Bacteria | 2973 |
| 81 | Ga0466722_184138 | 3300042609 | Bacteria | 65972 |
| 82 | Ga0123357_10058845 | 3300009784 | Bacteria | 5158 |
| 83 | Ga0123356_11505421 | 3300010049 | Bacteria | 830 |
| 84 | Ga0123353_10411522 | 3300010167 | Unclassified | 2008 |
| 85 | JGI24698J34947_10055213 | 3300002449 | Unclassified | 1980 |
| 86 | JGI24698J34947_10062401 | 3300002449 | Bacteria | 1830 |
| 87 | JGI24698J34947_10104422 | 3300002449 | Bacteria | 1265 |
| 88 | JGI24697J35500_11146666 | 3300002507 | Bacteria | 1333 |
| 89 | JGI24696J40584_12951020 | 3300002834 | Bacteria | 2202 |
| 90 | Ga0466705_188130 | 3300042612 | Unclassified | 2693 |
| 91 | Ga0466704_344372 | 3300042643 | Bacteria | 1900 |
| 92 | Ga0466709_083618 | 3300042648 | Bacteria | 11796 |
| 93 | Ga0466727_188047 | 3300042655 | Bacteria | 3070 |
| 94 | Ga0466712_183705 | 3300042614 | Bacteria | 17446 |
| 95 | Ga0466718_083664 | 3300042617 | Bacteria | 13092 |
| 96 | Ga0466691_067077 | 3300042593 | Bacteria | 1067 |
| 97 | Ga0466699_115103 | 3300042597 | Bacteria | 1542 |
| 98 | Ga0466698_175272 | 3300042610 | Bacteria | 1586 |
| 99 | JGI24698J34947_10005530 | 3300002449 | Bacteria | 6934 |
| 100 | JGI24698J34947_10025463 | 3300002449 | Bacteria | 3149 |
| 101 | JGI24698J34947_10039590 | 3300002449 | Bacteria | 2439 |
| 102 | JGI24698J34947_10159364 | 3300002449 | Bacteria | 926 |
| 103 | Ga0466708_247404 | 3300042652 | Bacteria | 13374 |
| 104 | Ga0466727_067336 | 3300042655 | Bacteria | 3082 |
| 105 | Ga0466715_331007 | 3300042616 | Bacteria | 1799 |
| 106 | Ga0466723_355777 | 3300042618 | Bacteria | 11299 |
| 107 | Ga0466723_358411 | 3300042618 | Bacteria | 1253 |
| 108 | JGI24695J34938_10021447 | 3300002450 | Bacteria | 3159 |
| 109 | JGI24702J35022_10305383 | 3300002462 | Bacteria | 940 |
| 110 | Ga0466729_275820 | 3300042621 | Bacteria | 1293 |
| 111 | Ga0466704_226396 | 3300042643 | Bacteria | 2071 |
| 112 | Ga0466704_485925 | 3300042643 | Bacteria | 6887 |
| 113 | Ga0466708_429070 | 3300042652 | Bacteria | 14209 |
| 114 | Ga0466715_092864 | 3300042616 | Bacteria | 3449 |
| 115 | Ga0466715_165766 | 3300042616 | Bacteria | 7401 |
| 116 | Ga0466718_044766 | 3300042617 | Bacteria | 3208 |
| 117 | Ga0466728_095360 | 3300042620 | Bacteria | 10327 |
| 118 | Ga0466690_187429 | 3300042590 | Bacteria | 7435 |
| 119 | Ga0466699_324647 | 3300042597 | Bacteria | 1078 |
| 120 | Ga0466700_045775 | 3300042600 | Bacteria | 3107 |
| 121 | Ga0466713_132558 | 3300042602 | Bacteria | 6671 |
| 122 | Ga0466719_575927 | 3300042606 | Bacteria | 4592 |
| 123 | JGI24698J34947_10019480 | 3300002449 | Bacteria | 3659 |
| 124 | JGI24698J34947_10041496 | 3300002449 | Bacteria | 2370 |
| 125 | JGI24698J34947_10045782 | 3300002449 | Bacteria | 2230 |
| 126 | JGI24698J34947_10057947 | 3300002449 | Bacteria | 1920 |
| 127 | JGI24705J35276_11677265 | 3300002504 | Bacteria | 623 |
| 128 | Ga0466705_054038 | 3300042612 | Bacteria | 24746 |
| 129 | Ga0466702_002318 | 3300042635 | Bacteria | 1468 |
| 130 | Ga0466703_126481 | 3300042636 | Bacteria | 13753 |
| 131 | Ga0466709_130863 | 3300042648 | Bacteria | 1134 |
| 132 | Ga0466709_347680 | 3300042648 | Bacteria | 22254 |
| 133 | Ga0466708_443020 | 3300042652 | Bacteria | 4921 |
| 134 | Ga0466705_411690 | 3300042612 | Bacteria | 3071 |
| 135 | Ga0466715_039219 | 3300042616 | Bacteria | 6433 |
| 136 | Ga0466715_266609 | 3300042616 | Bacteria | 3993 |
| 137 | Ga0466723_117696 | 3300042618 | Bacteria | 1379 |
| 138 | Ga0466723_129172 | 3300042618 | Bacteria | 33143 |
| 139 | Ga0466726_465855 | 3300042619 | Bacteria | 1969 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00436 | SSB | Single-strand binding protein family | 4 | 107 | 0.97 |
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF00436 | GO:0003697 | single-stranded DNA binding | MF |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.