Protein Family IF10214
Metagenome
Isolate
211
Members
37
Samples
206
Scaffolds
366.52
Avg Length
Representative Sequence
- ID
- 3300042655|Ga0466727_351652|Ga0466727_351652_513_1613
- Length
- 366 aa
- Sequence
- MKFTCDRSMLLKEIAIAQEIIASKNAISILSNIYLETGKDTLTIKATDTRVNFETKIPVTVLEEGSTTVFGDKFLGILNSIPEGDLEFDQKEAKINIKPSLKKIRFQLKSIASDKYPPFPVSGTSFFDIPVRDLKDMIMQTVFAVSDDETRYFMNGVFFEKTGDKLIMVATDGRRLAFSNKVVDTAISDFAGVIVPPKILNILMKRAGSEGSVSLSVTDKTLFIKFGSYNLSSILIEGQFPNYKRVIPESQNNSISVNRLEMLDALRRVSLMVESKSHRVYLGVAPGVMSVYSDENEIGTAKEEIPCKYEGEEISIALNYRYIEEPFKVMEEEEVFIRFGEPAKAITIMSVPEKDFFHIIMPMQLD
Sample Types
Isolate
2.4%
Metagenome
97.6%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Kalotermitidae
38.9%
Termitidae
22.2%
Unclassified
16.7%
Rhinotermitidae
11.1%
Termopsidae
8.3%
Hodotermitidae
2.8%
Taxonomy
Archaea
0
Bacteria
201
Eukaryota
0
Viruses
0
Unclassified
10
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2781125630 | Treponema sp. Nt197P3bin60 | Isolate | Unclassified |
| 2 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 3 | 3300002508 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 | Metagenome | Termitidae |
| 4 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 5 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 6 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 7 | 2781125683 | Treponema sp. Lab288P1bin34 | Isolate | Unclassified |
| 8 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 9 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 10 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 11 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 12 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 13 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 14 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 15 | 2781125629 | Treponema sp. Nt197P3bin20 | Isolate | Unclassified |
| 16 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 17 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 18 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 19 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 20 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 21 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 22 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 23 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 24 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 25 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 26 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 27 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 28 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 29 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 30 | 650716102 | Treponema primitia ZAS-2 | Isolate | Unclassified |
| 31 | 2772190978 | Treponema sp. Nt197P3bin57 | Isolate | Unclassified |
| 32 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 33 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 34 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 35 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 36 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 37 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_095752 | 3300042612 | Unclassified | 14829 |
| 2 | Ga0466733_139971 | 3300042659 | Bacteria | 42466 |
| 3 | Ga0466707_382604 | 3300042601 | Bacteria | 1496 |
| 4 | Ga0466722_026700 | 3300042609 | Bacteria | 11792 |
| 5 | Ga0466722_052316 | 3300042609 | Bacteria | 16679 |
| 6 | Ga0466698_063604 | 3300042610 | Bacteria | 1970 |
| 7 | Ga0466711_084660 | 3300042615 | Bacteria | 4919 |
| 8 | Ga0466715_181210 | 3300042616 | Bacteria | 5610 |
| 9 | Ga0466723_030620 | 3300042618 | Bacteria | 20868 |
| 10 | Ga0466723_172691 | 3300042618 | Bacteria | 15729 |
| 11 | Ga0466726_034168 | 3300042619 | Bacteria | 1706 |
| 12 | Ga0466726_048159 | 3300042619 | Bacteria | 2575 |
| 13 | Ga0466726_171360 | 3300042619 | Bacteria | 1803 |
| 14 | Ga0466726_174224 | 3300042619 | Bacteria | 9247 |
| 15 | Ga0466735_154863 | 3300042624 | Bacteria | 6699 |
| 16 | Ga0466704_096100 | 3300042643 | Bacteria | 4201 |
| 17 | Ga0466727_293715 | 3300042655 | Bacteria | 2371 |
| 18 | Ga0466690_198860 | 3300042590 | Bacteria | 38174 |
| 19 | Ga0466690_321613 | 3300042590 | Bacteria | 4224 |
| 20 | Ga0466692_068772 | 3300042591 | Bacteria | 2181 |
| 21 | Ga0466691_175704 | 3300042593 | Bacteria | 16463 |
| 22 | Ga0466696_015647 | 3300042596 | Bacteria | 26152 |
| 23 | Ga0466696_136348 | 3300042596 | Bacteria | 26578 |
| 24 | Ga0466696_175252 | 3300042596 | Bacteria | 19404 |
| 25 | Ga0466696_496243 | 3300042596 | Bacteria | 1706 |
| 26 | Ga0072941_1000616 | 3300005201 | Bacteria | 44438 |
| 27 | Ga0466705_101746 | 3300042612 | Bacteria | 6376 |
| 28 | Ga0466705_211709 | 3300042612 | Bacteria | 27987 |
| 29 | Ga0466705_338302 | 3300042612 | Bacteria | 26015 |
| 30 | Ga0466716_276920 | 3300042605 | Bacteria | 4319 |
| 31 | Ga0466716_298298 | 3300042605 | Unclassified | 7070 |
| 32 | Ga0466719_056438 | 3300042606 | Bacteria | 3701 |
| 33 | Ga0466719_103958 | 3300042606 | Unclassified | 1898 |
| 34 | Ga0466719_277749 | 3300042606 | Bacteria | 18545 |
| 35 | Ga0466722_149099 | 3300042609 | Bacteria | 14678 |
| 36 | Ga0466722_212916 | 3300042609 | Bacteria | 7486 |
| 37 | Ga0466711_511895 | 3300042615 | Bacteria | 100954 |
| 38 | Ga0466723_058213 | 3300042618 | Bacteria | 12501 |
| 39 | Ga0466726_168256 | 3300042619 | Bacteria | 1848 |
| 40 | Ga0466726_307871 | 3300042619 | Bacteria | 6020 |
| 41 | Ga0466726_357556 | 3300042619 | Bacteria | 1346 |
| 42 | Ga0466728_194693 | 3300042620 | Bacteria | 4082 |
| 43 | Ga0466735_021328 | 3300042624 | Bacteria | 13415 |
| 44 | Ga0466703_067793 | 3300042636 | Bacteria | 41172 |
| 45 | Ga0466704_273989 | 3300042643 | Bacteria | 40108 |
| 46 | Ga0466709_240294 | 3300042648 | Bacteria | 30912 |
| 47 | Ga0466708_036770 | 3300042652 | Bacteria | 11491 |
| 48 | Ga0466708_265130 | 3300042652 | Bacteria | 2370 |
| 49 | Ga0466708_427818 | 3300042652 | Bacteria | 41992 |
| 50 | Ga0466727_249096 | 3300042655 | Bacteria | 15683 |
| 51 | Ga0415639_044338 | 3300038395 | Bacteria | 2630 |
| 52 | Ga0466692_024573 | 3300042591 | Bacteria | 7738 |
| 53 | Ga0466692_090580 | 3300042591 | Bacteria | 14902 |
| 54 | Ga0466691_153202 | 3300042593 | Bacteria | 20163 |
| 55 | Ga0466696_073811 | 3300042596 | Bacteria | 2020 |
| 56 | Ga0466733_132381 | 3300042659 | Bacteria | 3295 |
| 57 | Ga0466716_282246 | 3300042605 | Bacteria | 6960 |
| 58 | Ga0466716_524688 | 3300042605 | Bacteria | 7412 |
| 59 | Ga0466719_067776 | 3300042606 | Bacteria | 17099 |
| 60 | Ga0466719_313436 | 3300042606 | Bacteria | 13463 |
| 61 | Ga0466719_431466 | 3300042606 | Bacteria | 12377 |
| 62 | Ga0466722_249114 | 3300042609 | Bacteria | 30516 |
| 63 | Ga0466715_050951 | 3300042616 | Bacteria | 15275 |
| 64 | Ga0466723_028506 | 3300042618 | Unclassified | 7323 |
| 65 | Ga0466723_145654 | 3300042618 | Bacteria | 5001 |
| 66 | Ga0466723_190426 | 3300042618 | Bacteria | 6127 |
| 67 | Ga0466723_311251 | 3300042618 | Bacteria | 4438 |
| 68 | Ga0466728_046774 | 3300042620 | Bacteria | 1257 |
| 69 | Ga0466728_101966 | 3300042620 | Bacteria | 40822 |
| 70 | Ga0466703_005144 | 3300042636 | Bacteria | 6079 |
| 71 | Ga0466703_076609 | 3300042636 | Bacteria | 8212 |
| 72 | Ga0466704_341978 | 3300042643 | Bacteria | 14032 |
| 73 | Ga0466708_363842 | 3300042652 | Bacteria | 4644 |
| 74 | Ga0466727_161175 | 3300042655 | Bacteria | 16380 |
| 75 | Ga0466727_234566 | 3300042655 | Unclassified | 4194 |
| 76 | Ga0456237_0000736 | 3300041968 | Bacteria | 5046 |
| 77 | Ga0466690_334955 | 3300042590 | Bacteria | 5347 |
| 78 | Ga0466692_192687 | 3300042591 | Bacteria | 10274 |
| 79 | Ga0466691_002114 | 3300042593 | Bacteria | 13302 |
| 80 | Ga0466691_035793 | 3300042593 | Unclassified | 17260 |
| 81 | Ga0466691_159619 | 3300042593 | Unclassified | 3827 |
| 82 | Ga0466705_012603 | 3300042612 | Bacteria | 5553 |
| 83 | Ga0466716_068723 | 3300042605 | Bacteria | 2870 |
| 84 | Ga0466716_096988 | 3300042605 | Bacteria | 4175 |
| 85 | Ga0466719_018543 | 3300042606 | Bacteria | 2795 |
| 86 | Ga0466722_167867 | 3300042609 | Bacteria | 10216 |
| 87 | Ga0466711_011919 | 3300042615 | Bacteria | 6018 |
| 88 | Ga0466711_500969 | 3300042615 | Bacteria | 12178 |
| 89 | Ga0466715_381753 | 3300042616 | Bacteria | 16729 |
| 90 | Ga0466723_074762 | 3300042618 | Bacteria | 12215 |
| 91 | Ga0466723_159151 | 3300042618 | Bacteria | 13980 |
| 92 | Ga0466726_389545 | 3300042619 | Bacteria | 6803 |
| 93 | Ga0466728_084005 | 3300042620 | Bacteria | 5520 |
| 94 | Ga0466728_143785 | 3300042620 | Bacteria | 10867 |
| 95 | Ga0466728_208502 | 3300042620 | Bacteria | 3489 |
| 96 | Ga0466728_351140 | 3300042620 | Bacteria | 6603 |
| 97 | Ga0466728_422045 | 3300042620 | Bacteria | 6587 |
| 98 | Ga0466703_025391 | 3300042636 | Bacteria | 1518 |
| 99 | Ga0466703_082358 | 3300042636 | Bacteria | 42973 |
| 100 | Ga0466704_030888 | 3300042643 | Bacteria | 6200 |
| 101 | Ga0466709_057473 | 3300042648 | Bacteria | 23735 |
| 102 | Ga0466709_135367 | 3300042648 | Bacteria | 9775 |
| 103 | Ga0466709_271615 | 3300042648 | Bacteria | 7530 |
| 104 | Ga0466708_030219 | 3300042652 | Bacteria | 5400 |
| 105 | Ga0466727_198863 | 3300042655 | Bacteria | 8105 |
| 106 | Ga0466690_001666 | 3300042590 | Unclassified | 2608 |
| 107 | Ga0466690_063534 | 3300042590 | Bacteria | 5512 |
| 108 | Ga0466690_113881 | 3300042590 | Bacteria | 15072 |
| 109 | Ga0466690_329663 | 3300042590 | Bacteria | 25608 |
| 110 | Ga0466692_083302 | 3300042591 | Bacteria | 3209 |
| 111 | Ga0466691_044652 | 3300042593 | Bacteria | 6318 |
| 112 | JGI24700J35501_10930701 | 3300002508 | Bacteria | 19213 |
| 113 | Ga0466705_352127 | 3300042612 | Bacteria | 4280 |
| 114 | Ga0466706_029221 | 3300042599 | Bacteria | 6089 |
| 115 | Ga0466707_353829 | 3300042601 | Bacteria | 1959 |
| 116 | Ga0466716_201502 | 3300042605 | Bacteria | 12901 |
| 117 | Ga0466716_271802 | 3300042605 | Bacteria | 8204 |
| 118 | Ga0466716_455829 | 3300042605 | Bacteria | 7386 |
| 119 | Ga0466719_248243 | 3300042606 | Bacteria | 8534 |
| 120 | Ga0466711_160727 | 3300042615 | Bacteria | 19687 |
| 121 | Ga0466718_069542 | 3300042617 | Bacteria | 7036 |
| 122 | Ga0466726_087824 | 3300042619 | Bacteria | 3749 |
| 123 | Ga0466726_246088 | 3300042619 | Bacteria | 13223 |
| 124 | Ga0466728_433304 | 3300042620 | Bacteria | 1537 |
| 125 | Ga0466728_433830 | 3300042620 | Unclassified | 1177 |
| 126 | Ga0466703_028466 | 3300042636 | Bacteria | 10144 |
| 127 | Ga0466708_236804 | 3300042652 | Bacteria | 16362 |
| 128 | Ga0466727_001614 | 3300042655 | Bacteria | 2525 |
| 129 | Ga0466690_101056 | 3300042590 | Bacteria | 12849 |
| 130 | Ga0466690_194351 | 3300042590 | Bacteria | 10286 |
| 131 | Ga0466690_244484 | 3300042590 | Bacteria | 6107 |
| 132 | Ga0466691_142383 | 3300042593 | Bacteria | 6583 |
| 133 | AustNasuHG_c1006703 | 3300000089 | Bacteria | 4105 |
| 134 | Ga0466727_351652 | 3300042655 | Bacteria | 1693 |
| 135 | Ga0466716_361365 | 3300042605 | Bacteria | 6160 |
| 136 | Ga0466719_054345 | 3300042606 | Bacteria | 28152 |
| 137 | Ga0466718_011811 | 3300042617 | Bacteria | 2950 |
| 138 | Ga0466723_148982 | 3300042618 | Bacteria | 5841 |
| 139 | Ga0466723_172079 | 3300042618 | Bacteria | 5999 |
| 140 | Ga0466726_027165 | 3300042619 | Bacteria | 19693 |
| 141 | Ga0466726_029876 | 3300042619 | Bacteria | 12572 |
| 142 | Ga0466729_241476 | 3300042621 | Bacteria | 1771 |
| 143 | Ga0466735_026144 | 3300042624 | Bacteria | 12817 |
| 144 | Ga0466703_102602 | 3300042636 | Bacteria | 21083 |
| 145 | Ga0466704_298822 | 3300042643 | Bacteria | 8445 |
| 146 | Ga0466709_252127 | 3300042648 | Bacteria | 7865 |
| 147 | Ga0466708_104507 | 3300042652 | Bacteria | 5512 |
| 148 | Ga0466708_187284 | 3300042652 | Bacteria | 3378 |
| 149 | Ga0466727_043043 | 3300042655 | Bacteria | 1354 |
| 150 | Ga0466690_375956 | 3300042590 | Bacteria | 9740 |
| 151 | Ga0466690_425722 | 3300042590 | Bacteria | 2001 |
| 152 | Ga0466691_000125 | 3300042593 | Bacteria | 15560 |
| 153 | Ga0466691_007748 | 3300042593 | Bacteria | 9549 |
| 154 | Ga0466691_068827 | 3300042593 | Bacteria | 1823 |
| 155 | Ga0466691_129266 | 3300042593 | Bacteria | 12965 |
| 156 | Ga0466691_151272 | 3300042593 | Bacteria | 7550 |
| 157 | Ga0466696_168179 | 3300042596 | Bacteria | 9090 |
| 158 | Ga0466699_000655 | 3300042597 | Bacteria | 10504 |
| 159 | Ga0072941_1000457 | 3300005201 | Bacteria | 13104 |
| 160 | Ga0466716_173189 | 3300042605 | Bacteria | 10968 |
| 161 | Ga0466716_204222 | 3300042605 | Bacteria | 1453 |
| 162 | Ga0466719_432047 | 3300042606 | Bacteria | 1760 |
| 163 | Ga0466719_564855 | 3300042606 | Unclassified | 4252 |
| 164 | Ga0466722_132342 | 3300042609 | Bacteria | 4487 |
| 165 | Ga0466722_243351 | 3300042609 | Bacteria | 9576 |
| 166 | Ga0466711_177266 | 3300042615 | Bacteria | 2729 |
| 167 | Ga0466711_371184 | 3300042615 | Bacteria | 5551 |
| 168 | Ga0466715_021318 | 3300042616 | Bacteria | 41129 |
| 169 | Ga0466715_115175 | 3300042616 | Bacteria | 11642 |
| 170 | Ga0466715_133139 | 3300042616 | Bacteria | 6201 |
| 171 | Ga0466723_055810 | 3300042618 | Bacteria | 20174 |
| 172 | Ga0466723_167050 | 3300042618 | Bacteria | 28171 |
| 173 | Ga0466723_229438 | 3300042618 | Bacteria | 4577 |
| 174 | Ga0466726_207112 | 3300042619 | Bacteria | 4336 |
| 175 | Ga0466728_025683 | 3300042620 | Bacteria | 20278 |
| 176 | Ga0466735_006667 | 3300042624 | Bacteria | 2849 |
| 177 | Ga0466703_020319 | 3300042636 | Bacteria | 5779 |
| 178 | Ga0466703_256104 | 3300042636 | Bacteria | 20139 |
| 179 | Ga0466709_016766 | 3300042648 | Bacteria | 5510 |
| 180 | Ga0466709_140954 | 3300042648 | Bacteria | 1294 |
| 181 | Ga0466708_132822 | 3300042652 | Bacteria | 34704 |
| 182 | Ga0466692_000560 | 3300042591 | Bacteria | 9690 |
| 183 | Ga0466692_066433 | 3300042591 | Bacteria | 43794 |
| 184 | Ga0466691_012038 | 3300042593 | Bacteria | 8990 |
| 185 | Ga0466691_023259 | 3300042593 | Bacteria | 5204 |
| 186 | Ga0466691_040585 | 3300042593 | Bacteria | 8606 |
| 187 | Ga0466705_348667 | 3300042612 | Bacteria | 9157 |
| 188 | Ga0466733_176323 | 3300042659 | Bacteria | 4591 |
| 189 | Ga0466733_194930 | 3300042659 | Bacteria | 2002 |
| 190 | Ga0466719_181890 | 3300042606 | Bacteria | 1950 |
| 191 | Ga0123353_10276883 | 3300010167 | Bacteria | 2580 |
| 192 | Ga0466711_259608 | 3300042615 | Bacteria | 24557 |
| 193 | Ga0466718_078640 | 3300042617 | Bacteria | 14183 |
| 194 | Ga0466723_094475 | 3300042618 | Bacteria | 3672 |
| 195 | Ga0466723_149187 | 3300042618 | Bacteria | 6385 |
| 196 | Ga0466703_366938 | 3300042636 | Bacteria | 8496 |
| 197 | Ga0466704_342116 | 3300042643 | Bacteria | 2100 |
| 198 | Ga0466709_169811 | 3300042648 | Bacteria | 5327 |
| 199 | Ga0466708_042001 | 3300042652 | Bacteria | 9901 |
| 200 | Ga0466708_222747 | 3300042652 | Bacteria | 18987 |
| 201 | Ga0466708_380127 | 3300042652 | Bacteria | 5869 |
| 202 | Ga0466708_439982 | 3300042652 | Bacteria | 2146 |
| 203 | Ga0466727_103054 | 3300042655 | Bacteria | 3144 |
| 204 | Ga0466690_166705 | 3300042590 | Bacteria | 3572 |
| 205 | Ga0466692_182520 | 3300042591 | Bacteria | 6811 |
| 206 | Ga0466691_051212 | 3300042593 | Bacteria | 3486 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.