Protein Family IF10210

Metagenome Isolate
228 Members
70 Samples
202 Scaffolds
596.33 Avg Length

🧬 Representative Sequence

ID
3300042655|Ga0466727_337006|Ga0466727_337006_1027_2841
Length
592 aa
Sequence
MAKKPREQKTAQNRNRYDVDEYLDEKVSLFNIRRCFRYLVQAKTHLSLALILSMVGNLASLMGPLFIQRALDVAVPNKDVKLLLTMAMFLGISIVVAITLGAIRNVLVARAGAGIIHNIRFDLFTHLQKLPFAFYDSRPHGKIFVRVVPYVNSVSDALSNGIINFVIERVSPRLATVTVLGLPVLALFIWTIKNAQRRAWQRVSNKNSNLNAYIQESIDGVKVTQAFDRQERNLGIMNKLTDDRNREWMRAQYISNTTWFSTETISQIVFSFVYIMGAYWMHPMASFGMLLVMGNYAWRFWQPIINLANIYNTFITAMSYLDRIFDTIAEPVKIKDVEGAVEFPFVRGHVEFKNVSFSYDGVRKVLNNVSFDGHPGESIAFVGPTGAGKTTIVNLLSRFYNIEEGQVCVDGQDIMKVTLKSLRSQMGIMLQDSFLFTGTIADNIRYGKLDATDEEIHAAARLIGADGFIEKLSQGYNTPISERGGGISQGERQLLAFSRTLISNPRILILDEATSSIDTGTEQLVQEGIRTLMKGRTSFIIAHRLSTIRDCSRIMYIKDGEIAEAGTHDQLMAKKGLYYQLYWTQHAEDADM

πŸ“Š Sample Types

Isolate 11.4%
Metagenome 88.6%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

πŸ› Taxa Family Distribution

Unclassified 39.7%
Termitidae 30.9%
Kalotermitidae 20.6%
Rhinotermitidae 5.9%
Termopsidae 2.9%

🌳 Taxonomy

Archaea 0
Bacteria 217
Eukaryota 0
Viruses 0
Unclassified 11

πŸ—‚οΈ Samples

#Sample IDDescriptionTypeTaxa Family
1 2781125660 Treponema sp. Emb289P3bin52 Isolate Unclassified
2 2781125666 Treponema sp. Emb289P4bin7 Isolate Unclassified
3 2819992462 Unclassified Spirochaetes Nc150P4bin14 Isolate Unclassified
4 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
5 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
6 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
7 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
8 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
9 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
10 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
11 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
12 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
13 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
14 2781125638 Treponema sp. Co191P1bin8 Isolate Unclassified
15 2781125649 Treponema sp. Co191P3bin15 Isolate Unclassified
16 2781125661 Treponema sp. Emb289P3bin69 Isolate Unclassified
17 2781125685 Treponema sp. Lab288P1bin13 Isolate Unclassified
18 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
19 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
20 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
21 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
22 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
23 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
24 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
25 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
26 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
27 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
28 2781125643 Treponema sp. Co191P3bin45 Isolate Unclassified
29 2781125648 Treponema sp. Co191P3bin70 Isolate Unclassified
30 2781125650 Treponema sp. Co191P3bin64 Isolate Unclassified
31 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
32 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
33 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
34 3300041968 Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 Metagenome Rhinotermitidae
35 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
36 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
37 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
38 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
39 2781125657 Treponema sp. Emb289P3bin15 Isolate Unclassified
40 2781125682 Treponema sp. Lab288P1bin107 Isolate Unclassified
41 2781125693 Treponema sp. Th196P3bin148 Isolate Unclassified
42 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
43 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
44 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
45 2781125644 Treponema sp. Co191P3bin12 Isolate Unclassified
46 2781125645 Treponema sp. Co191P3bin32 Isolate Unclassified
47 2781125656 Treponema sp. Emb289P1bin65 Isolate Unclassified
48 2781125665 Treponema sp. Emb289P3bin117 Isolate Unclassified
49 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
50 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
51 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
52 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
53 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
54 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
55 2781125635 Treponema sp. Co191P1bin60 Isolate Unclassified
56 2781125636 Treponema sp. Co191P1bin67 Isolate Unclassified
57 2781125662 Treponema sp. Emb289P3bin141 Isolate Unclassified
58 2781125689 Treponema sp. Mp193P4bin9 Isolate Unclassified
59 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
60 2781125637 Treponema sp. Co191P1bin9 Isolate Unclassified
61 2781125647 Treponema sp. Co191P3bin16 Isolate Unclassified
62 2781125659 Treponema sp. Emb289P3bin114 Isolate Unclassified
63 650716099 Leadbettera azotonutricia ZAS-9 Isolate Unclassified
64 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
65 2781125634 Treponema sp. Co191P1bin45 Isolate Unclassified
66 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
67 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
68 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
69 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
70 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae

πŸ”— Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_037046 3300042612 Bacteria 4576
2 Ga0466705_164526 3300042612 Bacteria 5211
3 Ga0466705_190510 3300042612 Unclassified 5079
4 Ga0466729_255423 3300042621 Bacteria 2014
5 Ga0466707_109380 3300042601 Bacteria 4326
6 Ga0466717_164360 3300042604 Bacteria 2621
7 Ga0466719_487139 3300042606 Bacteria 20745
8 Ga0466712_149203 3300042614 Bacteria 32878
9 Ga0466711_053160 3300042615 Bacteria 18091
10 Ga0466728_123109 3300042620 Bacteria 6472
11 Ga0466729_129525 3300042621 Bacteria 4319
12 Ga0123355_10131786 3300009826 Bacteria 3850
13 Ga0123356_10007859 3300010049 Bacteria 10619
14 Ga0466690_045769 3300042590 Bacteria 3390
15 Ga0466691_190727 3300042593 Bacteria 54279
16 Ga0466696_084711 3300042596 Bacteria 44294
17 JGI24698J34947_10025892 3300002449 Unclassified 3119
18 JGI24695J34938_10001598 3300002450 Bacteria 19063
19 JGI24695J34938_10002974 3300002450 Bacteria 12214
20 Ga0072941_1009692 3300005201 Bacteria 8969
21 Ga0466705_191130 3300042612 Bacteria 4621
22 Ga0466732_310751 3300042656 Bacteria 2137
23 Ga0466731_180348 3300042622 Bacteria 10212
24 Ga0466709_073799 3300042648 Bacteria 16479
25 Ga0466720_064292 3300042607 Bacteria 4801
26 Ga0466720_067446 3300042607 Bacteria 24525
27 Ga0466712_047287 3300042614 Bacteria 4061
28 Ga0466712_203591 3300042614 Bacteria 33442
29 Ga0466711_115556 3300042615 Bacteria 5845
30 Ga0466718_114610 3300042617 Bacteria 4709
31 Ga0123357_10077510 3300009784 Bacteria 4384
32 Ga0123356_10001432 3300010049 Bacteria 26388
33 Ga0415639_035533 3300038395 Bacteria 9498
34 Ga0466692_161086 3300042591 Bacteria 12796
35 Ga0466696_095268 3300042596 Unclassified 3194
36 Ga0466696_362955 3300042596 Bacteria 3135
37 JGI24698J34947_10005677 3300002449 Bacteria 6841
38 JGI24695J34938_10001451 3300002450 Bacteria 20065
39 JGI24695J34938_10002524 3300002450 Bacteria 13864
40 JGI24699J35502_11131635 3300002509 Bacteria 5878
41 Ga0072941_1001619 3300005201 Bacteria 33496
42 Ga0123357_10001776 3300009784 Bacteria 23337
43 Ga0466733_043980 3300042659 Bacteria 5112
44 Ga0466703_026950 3300042636 Bacteria 4881
45 Ga0466716_337937 3300042605 Bacteria 12127
46 Ga0466720_081005 3300042607 Bacteria 23451
47 Ga0466705_497211 3300042612 Bacteria 4182
48 Ga0466712_151194 3300042614 Bacteria 7015
49 Ga0123356_10005541 3300010049 Bacteria 12840
50 Ga0123356_10042238 3300010049 Bacteria 4248
51 Ga0466692_110548 3300042591 Bacteria 9219
52 Ga0466692_138672 3300042591 Bacteria 8530
53 Ga0466699_118175 3300042597 Bacteria 12097
54 Ga0466699_200335 3300042597 Bacteria 11655
55 Ga0466699_271541 3300042597 Bacteria 6024
56 Ga0466699_316192 3300042597 Bacteria 10047
57 JGI24698J34947_10009092 3300002449 Bacteria 5452
58 JGI24698J34947_10015883 3300002449 Bacteria 4094
59 JGI24698J34947_10046478 3300002449 Bacteria 2208
60 JGI24698J34947_10047133 3300002449 Bacteria 2189
61 JGI24695J34938_10000132 3300002450 Bacteria 67814
62 JGI24695J34938_10006630 3300002450 Bacteria 6910
63 JGI24695J34938_10009019 3300002450 Bacteria 5601
64 Ga0466705_002320 3300042612 Bacteria 9198
65 Ga0466705_081667 3300042612 Bacteria 21002
66 Ga0466702_178308 3300042635 Bacteria 4766
67 Ga0466703_061969 3300042636 Bacteria 9219
68 Ga0466703_331607 3300042636 Bacteria 15314
69 Ga0466703_430556 3300042636 Bacteria 37676
70 Ga0466704_551604 3300042643 Bacteria 4406
71 Ga0466708_079049 3300042652 Bacteria 28226
72 Ga0466708_243361 3300042652 Bacteria 6424
73 Ga0466708_257463 3300042652 Bacteria 4571
74 Ga0466712_055883 3300042614 Bacteria 7147
75 Ga0466715_413227 3300042616 Bacteria 8083
76 Ga0466723_233298 3300042618 Bacteria 3223
77 Ga0466723_239787 3300042618 Unclassified 5122
78 Ga0466726_418040 3300042619 Bacteria 3246
79 Ga0466728_095977 3300042620 Bacteria 12820
80 Ga0466728_175743 3300042620 Bacteria 25244
81 Ga0123356_10000512 3300010049 Bacteria 43209
82 Ga0123356_10049474 3300010049 Bacteria 3912
83 Ga0415639_009192 3300038395 Bacteria 4004
84 Ga0415639_021951 3300038395 Bacteria 22923
85 Ga0466692_154068 3300042591 Bacteria 3648
86 Ga0466691_197268 3300042593 Bacteria 14369
87 Ga0466694_097751 3300042594 Bacteria 12805
88 Ga0466694_365203 3300042594 Bacteria 39783
89 Ga0466694_368651 3300042594 Bacteria 4900
90 Ga0466695_315985 3300042595 Bacteria 38906
91 Ga0466699_426580 3300042597 Unclassified 16134
92 JGI24695J34938_10000129 3300002450 Bacteria 68011
93 JGI24695J34938_10001330 3300002450 Bacteria 21363
94 Ga0466731_146613 3300042622 Bacteria 26612
95 Ga0466703_068138 3300042636 Bacteria 8180
96 Ga0466716_073800 3300042605 Bacteria 3868
97 Ga0466719_231190 3300042606 Bacteria 18463
98 Ga0466719_256787 3300042606 Bacteria 21711
99 Ga0466720_050866 3300042607 Bacteria 29654
100 Ga0466712_049437 3300042614 Bacteria 5880
101 Ga0466711_001871 3300042615 Bacteria 22067
102 Ga0466711_135393 3300042615 Bacteria 49716
103 Ga0466715_099120 3300042616 Bacteria 6541
104 Ga0466718_101522 3300042617 Unclassified 3900
105 Ga0466726_344444 3300042619 Bacteria 27109
106 Ga0123356_10013526 3300010049 Bacteria 7873
107 Ga0123356_10069570 3300010049 Bacteria 3301
108 Ga0123353_10242607 3300010167 Bacteria 2798
109 Ga0456237_0003018 3300041968 Bacteria 2740
110 Ga0466692_026434 3300042591 Bacteria 6343
111 Ga0466694_027670 3300042594 Bacteria 10011
112 Ga0466694_080369 3300042594 Bacteria 15271
113 Ga0466694_400504 3300042594 Bacteria 7353
114 Ga0466696_114477 3300042596 Bacteria 20348
115 Ga0466699_434083 3300042597 Bacteria 5155
116 JGI24698J34947_10002018 3300002449 Bacteria 10825
117 JGI24698J34947_10004501 3300002449 Bacteria 7583
118 JGI24698J34947_10010966 3300002449 Bacteria 4974
119 JGI24698J34947_10047228 3300002449 Bacteria 2186
120 JGI24695J34938_10000812 3300002450 Bacteria 29016
121 JGI24695J34938_10002769 3300002450 Bacteria 12866
122 JGI24695J34938_10028186 3300002450 Bacteria 2642
123 Ga0072941_1017878 3300005201 Bacteria 30061
124 Ga0466732_091423 3300042656 Bacteria 29143
125 Ga0466709_314290 3300042648 Bacteria 6392
126 Ga0466709_408880 3300042648 Bacteria 11048
127 Ga0466708_088794 3300042652 Bacteria 5678
128 Ga0466708_326093 3300042652 Bacteria 30871
129 Ga0466727_337006 3300042655 Bacteria 4285
130 Ga0466716_015282 3300042605 Bacteria 25597
131 Ga0466720_053595 3300042607 Bacteria 3067
132 Ga0466721_315011 3300042608 Bacteria 3132
133 Ga0466722_163345 3300042609 Bacteria 4865
134 Ga0466705_440789 3300042612 Bacteria 4219
135 Ga0466712_117468 3300042614 Bacteria 53603
136 Ga0466712_232776 3300042614 Bacteria 5543
137 Ga0466711_093657 3300042615 Bacteria 14982
138 Ga0466715_039296 3300042616 Bacteria 4818
139 Ga0466718_151484 3300042617 Bacteria 15921
140 Ga0466723_160914 3300042618 Bacteria 17663
141 Ga0466726_111520 3300042619 Bacteria 2279
142 Ga0123353_10416329 3300010167 Bacteria 1993
143 Ga0264413_101301 3300024493 Bacteria 53125
144 Ga0466690_052026 3300042590 Bacteria 4309
145 Ga0466691_074149 3300042593 Bacteria 4325
146 Ga0466694_052783 3300042594 Bacteria 9647
147 Ga0466694_177393 3300042594 Bacteria 5060
148 Ga0466696_005819 3300042596 Bacteria 18142
149 Ga0466696_117494 3300042596 Bacteria 9783
150 Ga0466699_115252 3300042597 Unclassified 2694
151 Ga0466699_144835 3300042597 Bacteria 41381
152 Ga0466699_269179 3300042597 Bacteria 3909
153 JGI24695J34938_10000017 3300002450 Bacteria 115659
154 JGI24695J34938_10004711 3300002450 Bacteria 8828
155 Ga0466732_271039 3300042656 Bacteria 39163
156 Ga0466731_424307 3300042622 Bacteria 4140
157 Ga0466719_216438 3300042606 Bacteria 6079
158 Ga0466720_107517 3300042607 Bacteria 53647
159 Ga0466722_023071 3300042609 Bacteria 4964
160 Ga0466712_033199 3300042614 Bacteria 31590
161 Ga0466712_132203 3300042614 Bacteria 15768
162 Ga0466718_039732 3300042617 Bacteria 4106
163 Ga0466718_079470 3300042617 Bacteria 7118
164 Ga0466718_084534 3300042617 Bacteria 20764
165 Ga0466718_103230 3300042617 Unclassified 2405
166 Ga0466718_153800 3300042617 Bacteria 16494
167 Ga0123356_10000007 3300010049 Bacteria 240704
168 Ga0123353_10007222 3300010167 Bacteria 14967
169 Ga0466692_089494 3300042591 Bacteria 12277
170 Ga0466693_169172 3300042592 Bacteria 4452
171 Ga0466699_353783 3300042597 Bacteria 7202
172 JGI24698J34947_10001060 3300002449 Bacteria 14152
173 JGI24698J34947_10003297 3300002449 Bacteria 8749
174 JGI24698J34947_10006026 3300002449 Bacteria 6657
175 JGI24698J34947_10006592 3300002449 Bacteria 6379
176 JGI24698J34947_10042965 3300002449 Bacteria 2319
177 JGI24695J34938_10003609 3300002450 Bacteria 10633
178 Ga0466732_015385 3300042656 Bacteria 6960
179 Ga0466731_328762 3300042622 Bacteria 7378
180 Ga0466702_314936 3300042635 Bacteria 5242
181 Ga0466703_024068 3300042636 Unclassified 2480
182 Ga0466703_372166 3300042636 Bacteria 9131
183 Ga0466703_374078 3300042636 Bacteria 2830
184 Ga0466704_027988 3300042643 Bacteria 7520
185 Ga0466708_017154 3300042652 Bacteria 5286
186 Ga0466720_008510 3300042607 Bacteria 46869
187 Ga0466720_043093 3300042607 Bacteria 24879
188 Ga0466712_182905 3300042614 Bacteria 4705
189 Ga0466712_299391 3300042614 Bacteria 27724
190 Ga0466715_162642 3300042616 Bacteria 15689
191 Ga0466718_111150 3300042617 Bacteria 5579
192 Ga0466726_096344 3300042619 Bacteria 6037
193 Ga0466728_256853 3300042620 Bacteria 9990
194 Ga0466728_340784 3300042620 Bacteria 2850
195 Ga0123356_10000290 3300010049 Bacteria 57659
196 Ga0123356_10001798 3300010049 Bacteria 23357
197 Ga0466693_121705 3300042592 Bacteria 24410
198 Ga0466691_072318 3300042593 Bacteria 10078
199 Ga0466699_046088 3300042597 Bacteria 9098
200 JGI24698J34947_10019104 3300002449 Unclassified 3700
201 JGI24695J34938_10002603 3300002450 Bacteria 13582
202 JGI24695J34938_10025184 3300002450 Unclassified 2847

🧩 MSA Aligner

πŸ”¬ Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00664 ABC_membrane ABC transporter transmembrane region 47 293 0.94
PF00005 ABC_tran ABC transporter 366 515 0.9

πŸ—ΊοΈ Geographic Distribution

Some samples may be missing due to lack of coordinate data.