Protein Family IF10210
Metagenome
Isolate
228
Members
70
Samples
202
Scaffolds
596.33
Avg Length
Representative Sequence
- ID
- 3300042655|Ga0466727_337006|Ga0466727_337006_1027_2841
- Length
- 592 aa
- Sequence
- MAKKPREQKTAQNRNRYDVDEYLDEKVSLFNIRRCFRYLVQAKTHLSLALILSMVGNLASLMGPLFIQRALDVAVPNKDVKLLLTMAMFLGISIVVAITLGAIRNVLVARAGAGIIHNIRFDLFTHLQKLPFAFYDSRPHGKIFVRVVPYVNSVSDALSNGIINFVIERVSPRLATVTVLGLPVLALFIWTIKNAQRRAWQRVSNKNSNLNAYIQESIDGVKVTQAFDRQERNLGIMNKLTDDRNREWMRAQYISNTTWFSTETISQIVFSFVYIMGAYWMHPMASFGMLLVMGNYAWRFWQPIINLANIYNTFITAMSYLDRIFDTIAEPVKIKDVEGAVEFPFVRGHVEFKNVSFSYDGVRKVLNNVSFDGHPGESIAFVGPTGAGKTTIVNLLSRFYNIEEGQVCVDGQDIMKVTLKSLRSQMGIMLQDSFLFTGTIADNIRYGKLDATDEEIHAAARLIGADGFIEKLSQGYNTPISERGGGISQGERQLLAFSRTLISNPRILILDEATSSIDTGTEQLVQEGIRTLMKGRTSFIIAHRLSTIRDCSRIMYIKDGEIAEAGTHDQLMAKKGLYYQLYWTQHAEDADM
Sample Types
Isolate
11.4%
Metagenome
88.6%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Unclassified
39.7%
Termitidae
30.9%
Kalotermitidae
20.6%
Rhinotermitidae
5.9%
Termopsidae
2.9%
Taxonomy
Archaea
0
Bacteria
217
Eukaryota
0
Viruses
0
Unclassified
11
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2781125660 | Treponema sp. Emb289P3bin52 | Isolate | Unclassified |
| 2 | 2781125666 | Treponema sp. Emb289P4bin7 | Isolate | Unclassified |
| 3 | 2819992462 | Unclassified Spirochaetes Nc150P4bin14 | Isolate | Unclassified |
| 4 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 5 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 6 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 7 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 8 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 9 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 10 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 11 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 12 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 13 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 14 | 2781125638 | Treponema sp. Co191P1bin8 | Isolate | Unclassified |
| 15 | 2781125649 | Treponema sp. Co191P3bin15 | Isolate | Unclassified |
| 16 | 2781125661 | Treponema sp. Emb289P3bin69 | Isolate | Unclassified |
| 17 | 2781125685 | Treponema sp. Lab288P1bin13 | Isolate | Unclassified |
| 18 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 19 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 20 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 21 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 22 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 23 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 24 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 25 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 26 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 27 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 28 | 2781125643 | Treponema sp. Co191P3bin45 | Isolate | Unclassified |
| 29 | 2781125648 | Treponema sp. Co191P3bin70 | Isolate | Unclassified |
| 30 | 2781125650 | Treponema sp. Co191P3bin64 | Isolate | Unclassified |
| 31 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 32 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 33 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 34 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 35 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 36 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 37 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 38 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 39 | 2781125657 | Treponema sp. Emb289P3bin15 | Isolate | Unclassified |
| 40 | 2781125682 | Treponema sp. Lab288P1bin107 | Isolate | Unclassified |
| 41 | 2781125693 | Treponema sp. Th196P3bin148 | Isolate | Unclassified |
| 42 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 43 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 44 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 45 | 2781125644 | Treponema sp. Co191P3bin12 | Isolate | Unclassified |
| 46 | 2781125645 | Treponema sp. Co191P3bin32 | Isolate | Unclassified |
| 47 | 2781125656 | Treponema sp. Emb289P1bin65 | Isolate | Unclassified |
| 48 | 2781125665 | Treponema sp. Emb289P3bin117 | Isolate | Unclassified |
| 49 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 50 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 51 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 52 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 53 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 54 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 55 | 2781125635 | Treponema sp. Co191P1bin60 | Isolate | Unclassified |
| 56 | 2781125636 | Treponema sp. Co191P1bin67 | Isolate | Unclassified |
| 57 | 2781125662 | Treponema sp. Emb289P3bin141 | Isolate | Unclassified |
| 58 | 2781125689 | Treponema sp. Mp193P4bin9 | Isolate | Unclassified |
| 59 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 60 | 2781125637 | Treponema sp. Co191P1bin9 | Isolate | Unclassified |
| 61 | 2781125647 | Treponema sp. Co191P3bin16 | Isolate | Unclassified |
| 62 | 2781125659 | Treponema sp. Emb289P3bin114 | Isolate | Unclassified |
| 63 | 650716099 | Leadbettera azotonutricia ZAS-9 | Isolate | Unclassified |
| 64 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 65 | 2781125634 | Treponema sp. Co191P1bin45 | Isolate | Unclassified |
| 66 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 67 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 68 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 69 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 70 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_037046 | 3300042612 | Bacteria | 4576 |
| 2 | Ga0466705_164526 | 3300042612 | Bacteria | 5211 |
| 3 | Ga0466705_190510 | 3300042612 | Unclassified | 5079 |
| 4 | Ga0466729_255423 | 3300042621 | Bacteria | 2014 |
| 5 | Ga0466707_109380 | 3300042601 | Bacteria | 4326 |
| 6 | Ga0466717_164360 | 3300042604 | Bacteria | 2621 |
| 7 | Ga0466719_487139 | 3300042606 | Bacteria | 20745 |
| 8 | Ga0466712_149203 | 3300042614 | Bacteria | 32878 |
| 9 | Ga0466711_053160 | 3300042615 | Bacteria | 18091 |
| 10 | Ga0466728_123109 | 3300042620 | Bacteria | 6472 |
| 11 | Ga0466729_129525 | 3300042621 | Bacteria | 4319 |
| 12 | Ga0123355_10131786 | 3300009826 | Bacteria | 3850 |
| 13 | Ga0123356_10007859 | 3300010049 | Bacteria | 10619 |
| 14 | Ga0466690_045769 | 3300042590 | Bacteria | 3390 |
| 15 | Ga0466691_190727 | 3300042593 | Bacteria | 54279 |
| 16 | Ga0466696_084711 | 3300042596 | Bacteria | 44294 |
| 17 | JGI24698J34947_10025892 | 3300002449 | Unclassified | 3119 |
| 18 | JGI24695J34938_10001598 | 3300002450 | Bacteria | 19063 |
| 19 | JGI24695J34938_10002974 | 3300002450 | Bacteria | 12214 |
| 20 | Ga0072941_1009692 | 3300005201 | Bacteria | 8969 |
| 21 | Ga0466705_191130 | 3300042612 | Bacteria | 4621 |
| 22 | Ga0466732_310751 | 3300042656 | Bacteria | 2137 |
| 23 | Ga0466731_180348 | 3300042622 | Bacteria | 10212 |
| 24 | Ga0466709_073799 | 3300042648 | Bacteria | 16479 |
| 25 | Ga0466720_064292 | 3300042607 | Bacteria | 4801 |
| 26 | Ga0466720_067446 | 3300042607 | Bacteria | 24525 |
| 27 | Ga0466712_047287 | 3300042614 | Bacteria | 4061 |
| 28 | Ga0466712_203591 | 3300042614 | Bacteria | 33442 |
| 29 | Ga0466711_115556 | 3300042615 | Bacteria | 5845 |
| 30 | Ga0466718_114610 | 3300042617 | Bacteria | 4709 |
| 31 | Ga0123357_10077510 | 3300009784 | Bacteria | 4384 |
| 32 | Ga0123356_10001432 | 3300010049 | Bacteria | 26388 |
| 33 | Ga0415639_035533 | 3300038395 | Bacteria | 9498 |
| 34 | Ga0466692_161086 | 3300042591 | Bacteria | 12796 |
| 35 | Ga0466696_095268 | 3300042596 | Unclassified | 3194 |
| 36 | Ga0466696_362955 | 3300042596 | Bacteria | 3135 |
| 37 | JGI24698J34947_10005677 | 3300002449 | Bacteria | 6841 |
| 38 | JGI24695J34938_10001451 | 3300002450 | Bacteria | 20065 |
| 39 | JGI24695J34938_10002524 | 3300002450 | Bacteria | 13864 |
| 40 | JGI24699J35502_11131635 | 3300002509 | Bacteria | 5878 |
| 41 | Ga0072941_1001619 | 3300005201 | Bacteria | 33496 |
| 42 | Ga0123357_10001776 | 3300009784 | Bacteria | 23337 |
| 43 | Ga0466733_043980 | 3300042659 | Bacteria | 5112 |
| 44 | Ga0466703_026950 | 3300042636 | Bacteria | 4881 |
| 45 | Ga0466716_337937 | 3300042605 | Bacteria | 12127 |
| 46 | Ga0466720_081005 | 3300042607 | Bacteria | 23451 |
| 47 | Ga0466705_497211 | 3300042612 | Bacteria | 4182 |
| 48 | Ga0466712_151194 | 3300042614 | Bacteria | 7015 |
| 49 | Ga0123356_10005541 | 3300010049 | Bacteria | 12840 |
| 50 | Ga0123356_10042238 | 3300010049 | Bacteria | 4248 |
| 51 | Ga0466692_110548 | 3300042591 | Bacteria | 9219 |
| 52 | Ga0466692_138672 | 3300042591 | Bacteria | 8530 |
| 53 | Ga0466699_118175 | 3300042597 | Bacteria | 12097 |
| 54 | Ga0466699_200335 | 3300042597 | Bacteria | 11655 |
| 55 | Ga0466699_271541 | 3300042597 | Bacteria | 6024 |
| 56 | Ga0466699_316192 | 3300042597 | Bacteria | 10047 |
| 57 | JGI24698J34947_10009092 | 3300002449 | Bacteria | 5452 |
| 58 | JGI24698J34947_10015883 | 3300002449 | Bacteria | 4094 |
| 59 | JGI24698J34947_10046478 | 3300002449 | Bacteria | 2208 |
| 60 | JGI24698J34947_10047133 | 3300002449 | Bacteria | 2189 |
| 61 | JGI24695J34938_10000132 | 3300002450 | Bacteria | 67814 |
| 62 | JGI24695J34938_10006630 | 3300002450 | Bacteria | 6910 |
| 63 | JGI24695J34938_10009019 | 3300002450 | Bacteria | 5601 |
| 64 | Ga0466705_002320 | 3300042612 | Bacteria | 9198 |
| 65 | Ga0466705_081667 | 3300042612 | Bacteria | 21002 |
| 66 | Ga0466702_178308 | 3300042635 | Bacteria | 4766 |
| 67 | Ga0466703_061969 | 3300042636 | Bacteria | 9219 |
| 68 | Ga0466703_331607 | 3300042636 | Bacteria | 15314 |
| 69 | Ga0466703_430556 | 3300042636 | Bacteria | 37676 |
| 70 | Ga0466704_551604 | 3300042643 | Bacteria | 4406 |
| 71 | Ga0466708_079049 | 3300042652 | Bacteria | 28226 |
| 72 | Ga0466708_243361 | 3300042652 | Bacteria | 6424 |
| 73 | Ga0466708_257463 | 3300042652 | Bacteria | 4571 |
| 74 | Ga0466712_055883 | 3300042614 | Bacteria | 7147 |
| 75 | Ga0466715_413227 | 3300042616 | Bacteria | 8083 |
| 76 | Ga0466723_233298 | 3300042618 | Bacteria | 3223 |
| 77 | Ga0466723_239787 | 3300042618 | Unclassified | 5122 |
| 78 | Ga0466726_418040 | 3300042619 | Bacteria | 3246 |
| 79 | Ga0466728_095977 | 3300042620 | Bacteria | 12820 |
| 80 | Ga0466728_175743 | 3300042620 | Bacteria | 25244 |
| 81 | Ga0123356_10000512 | 3300010049 | Bacteria | 43209 |
| 82 | Ga0123356_10049474 | 3300010049 | Bacteria | 3912 |
| 83 | Ga0415639_009192 | 3300038395 | Bacteria | 4004 |
| 84 | Ga0415639_021951 | 3300038395 | Bacteria | 22923 |
| 85 | Ga0466692_154068 | 3300042591 | Bacteria | 3648 |
| 86 | Ga0466691_197268 | 3300042593 | Bacteria | 14369 |
| 87 | Ga0466694_097751 | 3300042594 | Bacteria | 12805 |
| 88 | Ga0466694_365203 | 3300042594 | Bacteria | 39783 |
| 89 | Ga0466694_368651 | 3300042594 | Bacteria | 4900 |
| 90 | Ga0466695_315985 | 3300042595 | Bacteria | 38906 |
| 91 | Ga0466699_426580 | 3300042597 | Unclassified | 16134 |
| 92 | JGI24695J34938_10000129 | 3300002450 | Bacteria | 68011 |
| 93 | JGI24695J34938_10001330 | 3300002450 | Bacteria | 21363 |
| 94 | Ga0466731_146613 | 3300042622 | Bacteria | 26612 |
| 95 | Ga0466703_068138 | 3300042636 | Bacteria | 8180 |
| 96 | Ga0466716_073800 | 3300042605 | Bacteria | 3868 |
| 97 | Ga0466719_231190 | 3300042606 | Bacteria | 18463 |
| 98 | Ga0466719_256787 | 3300042606 | Bacteria | 21711 |
| 99 | Ga0466720_050866 | 3300042607 | Bacteria | 29654 |
| 100 | Ga0466712_049437 | 3300042614 | Bacteria | 5880 |
| 101 | Ga0466711_001871 | 3300042615 | Bacteria | 22067 |
| 102 | Ga0466711_135393 | 3300042615 | Bacteria | 49716 |
| 103 | Ga0466715_099120 | 3300042616 | Bacteria | 6541 |
| 104 | Ga0466718_101522 | 3300042617 | Unclassified | 3900 |
| 105 | Ga0466726_344444 | 3300042619 | Bacteria | 27109 |
| 106 | Ga0123356_10013526 | 3300010049 | Bacteria | 7873 |
| 107 | Ga0123356_10069570 | 3300010049 | Bacteria | 3301 |
| 108 | Ga0123353_10242607 | 3300010167 | Bacteria | 2798 |
| 109 | Ga0456237_0003018 | 3300041968 | Bacteria | 2740 |
| 110 | Ga0466692_026434 | 3300042591 | Bacteria | 6343 |
| 111 | Ga0466694_027670 | 3300042594 | Bacteria | 10011 |
| 112 | Ga0466694_080369 | 3300042594 | Bacteria | 15271 |
| 113 | Ga0466694_400504 | 3300042594 | Bacteria | 7353 |
| 114 | Ga0466696_114477 | 3300042596 | Bacteria | 20348 |
| 115 | Ga0466699_434083 | 3300042597 | Bacteria | 5155 |
| 116 | JGI24698J34947_10002018 | 3300002449 | Bacteria | 10825 |
| 117 | JGI24698J34947_10004501 | 3300002449 | Bacteria | 7583 |
| 118 | JGI24698J34947_10010966 | 3300002449 | Bacteria | 4974 |
| 119 | JGI24698J34947_10047228 | 3300002449 | Bacteria | 2186 |
| 120 | JGI24695J34938_10000812 | 3300002450 | Bacteria | 29016 |
| 121 | JGI24695J34938_10002769 | 3300002450 | Bacteria | 12866 |
| 122 | JGI24695J34938_10028186 | 3300002450 | Bacteria | 2642 |
| 123 | Ga0072941_1017878 | 3300005201 | Bacteria | 30061 |
| 124 | Ga0466732_091423 | 3300042656 | Bacteria | 29143 |
| 125 | Ga0466709_314290 | 3300042648 | Bacteria | 6392 |
| 126 | Ga0466709_408880 | 3300042648 | Bacteria | 11048 |
| 127 | Ga0466708_088794 | 3300042652 | Bacteria | 5678 |
| 128 | Ga0466708_326093 | 3300042652 | Bacteria | 30871 |
| 129 | Ga0466727_337006 | 3300042655 | Bacteria | 4285 |
| 130 | Ga0466716_015282 | 3300042605 | Bacteria | 25597 |
| 131 | Ga0466720_053595 | 3300042607 | Bacteria | 3067 |
| 132 | Ga0466721_315011 | 3300042608 | Bacteria | 3132 |
| 133 | Ga0466722_163345 | 3300042609 | Bacteria | 4865 |
| 134 | Ga0466705_440789 | 3300042612 | Bacteria | 4219 |
| 135 | Ga0466712_117468 | 3300042614 | Bacteria | 53603 |
| 136 | Ga0466712_232776 | 3300042614 | Bacteria | 5543 |
| 137 | Ga0466711_093657 | 3300042615 | Bacteria | 14982 |
| 138 | Ga0466715_039296 | 3300042616 | Bacteria | 4818 |
| 139 | Ga0466718_151484 | 3300042617 | Bacteria | 15921 |
| 140 | Ga0466723_160914 | 3300042618 | Bacteria | 17663 |
| 141 | Ga0466726_111520 | 3300042619 | Bacteria | 2279 |
| 142 | Ga0123353_10416329 | 3300010167 | Bacteria | 1993 |
| 143 | Ga0264413_101301 | 3300024493 | Bacteria | 53125 |
| 144 | Ga0466690_052026 | 3300042590 | Bacteria | 4309 |
| 145 | Ga0466691_074149 | 3300042593 | Bacteria | 4325 |
| 146 | Ga0466694_052783 | 3300042594 | Bacteria | 9647 |
| 147 | Ga0466694_177393 | 3300042594 | Bacteria | 5060 |
| 148 | Ga0466696_005819 | 3300042596 | Bacteria | 18142 |
| 149 | Ga0466696_117494 | 3300042596 | Bacteria | 9783 |
| 150 | Ga0466699_115252 | 3300042597 | Unclassified | 2694 |
| 151 | Ga0466699_144835 | 3300042597 | Bacteria | 41381 |
| 152 | Ga0466699_269179 | 3300042597 | Bacteria | 3909 |
| 153 | JGI24695J34938_10000017 | 3300002450 | Bacteria | 115659 |
| 154 | JGI24695J34938_10004711 | 3300002450 | Bacteria | 8828 |
| 155 | Ga0466732_271039 | 3300042656 | Bacteria | 39163 |
| 156 | Ga0466731_424307 | 3300042622 | Bacteria | 4140 |
| 157 | Ga0466719_216438 | 3300042606 | Bacteria | 6079 |
| 158 | Ga0466720_107517 | 3300042607 | Bacteria | 53647 |
| 159 | Ga0466722_023071 | 3300042609 | Bacteria | 4964 |
| 160 | Ga0466712_033199 | 3300042614 | Bacteria | 31590 |
| 161 | Ga0466712_132203 | 3300042614 | Bacteria | 15768 |
| 162 | Ga0466718_039732 | 3300042617 | Bacteria | 4106 |
| 163 | Ga0466718_079470 | 3300042617 | Bacteria | 7118 |
| 164 | Ga0466718_084534 | 3300042617 | Bacteria | 20764 |
| 165 | Ga0466718_103230 | 3300042617 | Unclassified | 2405 |
| 166 | Ga0466718_153800 | 3300042617 | Bacteria | 16494 |
| 167 | Ga0123356_10000007 | 3300010049 | Bacteria | 240704 |
| 168 | Ga0123353_10007222 | 3300010167 | Bacteria | 14967 |
| 169 | Ga0466692_089494 | 3300042591 | Bacteria | 12277 |
| 170 | Ga0466693_169172 | 3300042592 | Bacteria | 4452 |
| 171 | Ga0466699_353783 | 3300042597 | Bacteria | 7202 |
| 172 | JGI24698J34947_10001060 | 3300002449 | Bacteria | 14152 |
| 173 | JGI24698J34947_10003297 | 3300002449 | Bacteria | 8749 |
| 174 | JGI24698J34947_10006026 | 3300002449 | Bacteria | 6657 |
| 175 | JGI24698J34947_10006592 | 3300002449 | Bacteria | 6379 |
| 176 | JGI24698J34947_10042965 | 3300002449 | Bacteria | 2319 |
| 177 | JGI24695J34938_10003609 | 3300002450 | Bacteria | 10633 |
| 178 | Ga0466732_015385 | 3300042656 | Bacteria | 6960 |
| 179 | Ga0466731_328762 | 3300042622 | Bacteria | 7378 |
| 180 | Ga0466702_314936 | 3300042635 | Bacteria | 5242 |
| 181 | Ga0466703_024068 | 3300042636 | Unclassified | 2480 |
| 182 | Ga0466703_372166 | 3300042636 | Bacteria | 9131 |
| 183 | Ga0466703_374078 | 3300042636 | Bacteria | 2830 |
| 184 | Ga0466704_027988 | 3300042643 | Bacteria | 7520 |
| 185 | Ga0466708_017154 | 3300042652 | Bacteria | 5286 |
| 186 | Ga0466720_008510 | 3300042607 | Bacteria | 46869 |
| 187 | Ga0466720_043093 | 3300042607 | Bacteria | 24879 |
| 188 | Ga0466712_182905 | 3300042614 | Bacteria | 4705 |
| 189 | Ga0466712_299391 | 3300042614 | Bacteria | 27724 |
| 190 | Ga0466715_162642 | 3300042616 | Bacteria | 15689 |
| 191 | Ga0466718_111150 | 3300042617 | Bacteria | 5579 |
| 192 | Ga0466726_096344 | 3300042619 | Bacteria | 6037 |
| 193 | Ga0466728_256853 | 3300042620 | Bacteria | 9990 |
| 194 | Ga0466728_340784 | 3300042620 | Bacteria | 2850 |
| 195 | Ga0123356_10000290 | 3300010049 | Bacteria | 57659 |
| 196 | Ga0123356_10001798 | 3300010049 | Bacteria | 23357 |
| 197 | Ga0466693_121705 | 3300042592 | Bacteria | 24410 |
| 198 | Ga0466691_072318 | 3300042593 | Bacteria | 10078 |
| 199 | Ga0466699_046088 | 3300042597 | Bacteria | 9098 |
| 200 | JGI24698J34947_10019104 | 3300002449 | Unclassified | 3700 |
| 201 | JGI24695J34938_10002603 | 3300002450 | Bacteria | 13582 |
| 202 | JGI24695J34938_10025184 | 3300002450 | Unclassified | 2847 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.