Protein Family IF10167
Metagenome
Isolate
143
Members
45
Samples
139
Scaffolds
199.6
Avg Length
Representative Sequence
- ID
- 3300042655|Ga0466727_214822|Ga0466727_214822_343_1011
- Length
- 222 aa
- Sequence
- MAIVVEHEKRRREILERALDVFVEEGFENATYQKIADRSGITRTTLYIYFHNKREIFNFSIKQLLSEFETDLNRVRKEDLPYPEKLKKTISFILKTLEINRRLLSVILDYLFYLARQESAKQLAGVPAKPRRDKASAEAPGTIDTRVRRRTIRLRHILSSMVIDGIKAGELKKLDVKTINDLLYGLIETAIFHMAVLKRPSAGDLREAVNLLVDQIAEQKER
Sample Types
Isolate
2.8%
Metagenome
97.2%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
38.6%
Kalotermitidae
31.8%
Unclassified
13.6%
Rhinotermitidae
9.1%
Termopsidae
6.8%
Taxonomy
Archaea
1
Bacteria
134
Eukaryota
0
Viruses
0
Unclassified
8
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 2 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 3 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 4 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 5 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 6 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 7 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 8 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 9 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 10 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 11 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 12 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 13 | 2781125652 | Treponema sp. Cu122P5bin1 | Isolate | Unclassified |
| 14 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 15 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 16 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 17 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 18 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 19 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 20 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 21 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 22 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 23 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 24 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 25 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 26 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 27 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 28 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 29 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 30 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 31 | 2781125659 | Treponema sp. Emb289P3bin114 | Isolate | Unclassified |
| 32 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 33 | 2781125640 | Treponema sp. Co191P1bin37 | Isolate | Unclassified |
| 34 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 35 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 36 | 2781125682 | Treponema sp. Lab288P1bin107 | Isolate | Unclassified |
| 37 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 38 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 39 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 40 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 41 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 42 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 43 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 44 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 45 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_038831 | 3300042612 | Bacteria | 1977 |
| 2 | Ga0466712_112866 | 3300042614 | Unclassified | 5985 |
| 3 | Ga0466711_472570 | 3300042615 | Bacteria | 1146 |
| 4 | Ga0466715_155956 | 3300042616 | Bacteria | 3202 |
| 5 | Ga0466723_227236 | 3300042618 | Bacteria | 5030 |
| 6 | Ga0415639_011990 | 3300038395 | Bacteria | 15522 |
| 7 | Ga0456237_0002614 | 3300041968 | Bacteria | 2907 |
| 8 | Ga0466694_342486 | 3300042594 | Bacteria | 1753 |
| 9 | Ga0466696_441242 | 3300042596 | Bacteria | 17147 |
| 10 | Ga0466704_058460 | 3300042643 | Unclassified | 1126 |
| 11 | Ga0466727_214822 | 3300042655 | Bacteria | 1273 |
| 12 | Ga0466719_373371 | 3300042606 | Bacteria | 2327 |
| 13 | JGI24698J34947_10003434 | 3300002449 | Bacteria | 8600 |
| 14 | JGI24695J34938_10006715 | 3300002450 | Bacteria | 6853 |
| 15 | Ga0072941_1004963 | 3300005201 | Bacteria | 2315 |
| 16 | Ga0123356_10073401 | 3300010049 | Bacteria | 3217 |
| 17 | Ga0466712_147952 | 3300042614 | Bacteria | 11335 |
| 18 | Ga0466723_006520 | 3300042618 | Bacteria | 34438 |
| 19 | Ga0466723_071252 | 3300042618 | Bacteria | 58514 |
| 20 | Ga0466690_031567 | 3300042590 | Bacteria | 39446 |
| 21 | Ga0466692_097037 | 3300042591 | Bacteria | 7204 |
| 22 | Ga0466692_121742 | 3300042591 | Bacteria | 12345 |
| 23 | Ga0466692_190645 | 3300042591 | Bacteria | 3323 |
| 24 | Ga0466694_060748 | 3300042594 | Bacteria | 1822 |
| 25 | Ga0466696_127760 | 3300042596 | Bacteria | 4912 |
| 26 | Ga0466709_379747 | 3300042648 | Bacteria | 11033 |
| 27 | Ga0466708_107418 | 3300042652 | Bacteria | 7720 |
| 28 | Ga0466716_194058 | 3300042605 | Bacteria | 14870 |
| 29 | Ga0466716_218754 | 3300042605 | Bacteria | 13081 |
| 30 | JGI24698J34947_10031143 | 3300002449 | Bacteria | 2810 |
| 31 | JGI24695J34938_10027417 | 3300002450 | Bacteria | 2693 |
| 32 | JGI24695J34938_10035253 | 3300002450 | Bacteria | 2289 |
| 33 | Ga0072941_1041319 | 3300005201 | Unclassified | 4258 |
| 34 | Ga0123357_10128338 | 3300009784 | Bacteria | 3167 |
| 35 | Ga0123353_10069987 | 3300010167 | Bacteria | 5636 |
| 36 | Ga0466711_259608 | 3300042615 | Bacteria | 24557 |
| 37 | Ga0466723_331842 | 3300042618 | Bacteria | 10387 |
| 38 | Ga0466726_333312 | 3300042619 | Bacteria | 2020 |
| 39 | Ga0456237_0000529 | 3300041968 | Bacteria | 5816 |
| 40 | Ga0466692_186185 | 3300042591 | Bacteria | 2364 |
| 41 | Ga0466693_110881 | 3300042592 | Bacteria | 3758 |
| 42 | Ga0466693_140469 | 3300042592 | Bacteria | 1458 |
| 43 | Ga0466694_181681 | 3300042594 | Bacteria | 2529 |
| 44 | Ga0466703_082278 | 3300042636 | Bacteria | 15950 |
| 45 | Ga0466704_068054 | 3300042643 | Bacteria | 10568 |
| 46 | Ga0466704_110192 | 3300042643 | Bacteria | 29526 |
| 47 | Ga0466704_117362 | 3300042643 | Bacteria | 4464 |
| 48 | Ga0466709_148175 | 3300042648 | Bacteria | 5725 |
| 49 | Ga0466708_008964 | 3300042652 | Bacteria | 1043 |
| 50 | Ga0466708_061397 | 3300042652 | Bacteria | 3445 |
| 51 | Ga0466727_130717 | 3300042655 | Bacteria | 2370 |
| 52 | Ga0466713_074952 | 3300042602 | Bacteria | 2322 |
| 53 | Ga0466716_029968 | 3300042605 | Bacteria | 12259 |
| 54 | Ga0466719_072003 | 3300042606 | Bacteria | 2449 |
| 55 | JGI24695J34938_10163398 | 3300002450 | Bacteria | 916 |
| 56 | Ga0072941_1041318 | 3300005201 | Bacteria | 2154 |
| 57 | Ga0466715_146553 | 3300042616 | Bacteria | 21620 |
| 58 | Ga0466715_186421 | 3300042616 | Bacteria | 2931 |
| 59 | Ga0466728_018717 | 3300042620 | Bacteria | 5732 |
| 60 | Ga0415639_007546 | 3300038395 | Unclassified | 5221 |
| 61 | Ga0466690_312359 | 3300042590 | Bacteria | 11963 |
| 62 | Ga0466691_081253 | 3300042593 | Bacteria | 21841 |
| 63 | Ga0466694_344780 | 3300042594 | Bacteria | 3571 |
| 64 | Ga0466699_350840 | 3300042597 | Bacteria | 1242 |
| 65 | Ga0466702_123394 | 3300042635 | Bacteria | 1996 |
| 66 | Ga0466703_187674 | 3300042636 | Bacteria | 2738 |
| 67 | Ga0466709_002003 | 3300042648 | Bacteria | 2083 |
| 68 | Ga0466709_223489 | 3300042648 | Bacteria | 5208 |
| 69 | Ga0466708_128755 | 3300042652 | Bacteria | 6941 |
| 70 | Ga0466707_057707 | 3300042601 | Bacteria | 7597 |
| 71 | JGI24698J34947_10185176 | 3300002449 | Unclassified | 828 |
| 72 | Ga0123356_10001800 | 3300010049 | Bacteria | 23343 |
| 73 | Ga0123356_10010655 | 3300010049 | Bacteria | 8999 |
| 74 | Ga0123353_10012997 | 3300010167 | Bacteria | 11894 |
| 75 | Ga0466705_412095 | 3300042612 | Bacteria | 7608 |
| 76 | Ga0466711_300254 | 3300042615 | Bacteria | 7469 |
| 77 | Ga0466715_269665 | 3300042616 | Bacteria | 14613 |
| 78 | Ga0466723_146638 | 3300042618 | Unclassified | 11023 |
| 79 | Ga0466723_288324 | 3300042618 | Bacteria | 8465 |
| 80 | Ga0466691_063795 | 3300042593 | Bacteria | 2087 |
| 81 | Ga0466694_000504 | 3300042594 | Bacteria | 3674 |
| 82 | Ga0466694_140171 | 3300042594 | Bacteria | 3398 |
| 83 | Ga0466695_029002 | 3300042595 | Bacteria | 6606 |
| 84 | Ga0466699_417095 | 3300042597 | Bacteria | 1615 |
| 85 | Ga0466708_321737 | 3300042652 | Bacteria | 61371 |
| 86 | Ga0466707_325893 | 3300042601 | Bacteria | 1602 |
| 87 | Ga0466707_356508 | 3300042601 | Bacteria | 1192 |
| 88 | Ga0466722_115375 | 3300042609 | Bacteria | 9951 |
| 89 | Ga0466722_143103 | 3300042609 | Bacteria | 17036 |
| 90 | JGI24695J34938_10012348 | 3300002450 | Bacteria | 4531 |
| 91 | JGI24695J34938_10017234 | 3300002450 | Bacteria | 3647 |
| 92 | Ga0072940_1099341 | 3300005200 | Bacteria | 4230 |
| 93 | Ga0123353_10347122 | 3300010167 | Bacteria | 2238 |
| 94 | Ga0466705_034622 | 3300042612 | Bacteria | 3073 |
| 95 | Ga0466705_070798 | 3300042612 | Bacteria | 7405 |
| 96 | Ga0466711_158478 | 3300042615 | Bacteria | 16488 |
| 97 | Ga0466728_234115 | 3300042620 | Bacteria | 1731 |
| 98 | Ga0466728_361378 | 3300042620 | Bacteria | 1164 |
| 99 | Ga0466699_397590 | 3300042597 | Bacteria | 9455 |
| 100 | Ga0466703_429046 | 3300042636 | Bacteria | 11698 |
| 101 | Ga0466719_572501 | 3300042606 | Bacteria | 5204 |
| 102 | Ga0466698_009270 | 3300042610 | Bacteria | 1011 |
| 103 | Ga0072941_1041320 | 3300005201 | Bacteria | 6628 |
| 104 | Ga0466711_067069 | 3300042615 | Bacteria | 6276 |
| 105 | Ga0466715_347823 | 3300042616 | Bacteria | 6769 |
| 106 | Ga0466691_107904 | 3300042593 | Bacteria | 7442 |
| 107 | Ga0466696_442882 | 3300042596 | Bacteria | 4580 |
| 108 | Ga0466735_227067 | 3300042624 | Bacteria | 1269 |
| 109 | Ga0466703_100612 | 3300042636 | Bacteria | 66039 |
| 110 | Ga0466704_146832 | 3300042643 | Unclassified | 5847 |
| 111 | Ga0466704_224550 | 3300042643 | Bacteria | 1791 |
| 112 | Ga0466704_299238 | 3300042643 | Bacteria | 3887 |
| 113 | Ga0466709_167604 | 3300042648 | Bacteria | 1214 |
| 114 | Ga0466708_064447 | 3300042652 | Bacteria | 4468 |
| 115 | Ga0466707_367166 | 3300042601 | Bacteria | 1250 |
| 116 | Ga0466719_092423 | 3300042606 | Unclassified | 3079 |
| 117 | Ga0466719_285951 | 3300042606 | Bacteria | 1736 |
| 118 | Ga0466721_191339 | 3300042608 | Bacteria | 79638 |
| 119 | Ga0466722_027035 | 3300042609 | Bacteria | 9083 |
| 120 | Ga0466698_130509 | 3300042610 | Bacteria | 8047 |
| 121 | Ga0072941_1116324 | 3300005201 | Bacteria | 2508 |
| 122 | Ga0123357_10215754 | 3300009784 | Bacteria | 2143 |
| 123 | Ga0123356_10014911 | 3300010049 | Archaea | 7460 |
| 124 | Ga0123356_10241472 | 3300010049 | Bacteria | 1878 |
| 125 | Ga0123356_11642346 | 3300010049 | Bacteria | 796 |
| 126 | Ga0123353_11976325 | 3300010167 | Bacteria | 716 |
| 127 | Ga0466705_160689 | 3300042612 | Bacteria | 2934 |
| 128 | Ga0466712_113300 | 3300042614 | Bacteria | 2684 |
| 129 | Ga0466712_239387 | 3300042614 | Bacteria | 10434 |
| 130 | Ga0466715_148608 | 3300042616 | Bacteria | 20383 |
| 131 | Ga0466728_097758 | 3300042620 | Bacteria | 24556 |
| 132 | Ga0466691_063212 | 3300042593 | Bacteria | 1767 |
| 133 | Ga0466729_230609 | 3300042621 | Bacteria | 3362 |
| 134 | Ga0466703_093576 | 3300042636 | Bacteria | 8952 |
| 135 | Ga0466708_245071 | 3300042652 | Bacteria | 13931 |
| 136 | Ga0466727_201286 | 3300042655 | Bacteria | 2490 |
| 137 | JGI24698J34947_10062356 | 3300002449 | Bacteria | 1831 |
| 138 | Ga0123355_10012757 | 3300009826 | Bacteria | 13031 |
| 139 | Ga0123354_10356021 | 3300010882 | Bacteria | 1298 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00440 | TetR_N | Bacterial regulatory proteins, tetR family | 14 | 57 | 0.98 |
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF00440 | GO:0003677 | DNA binding | MF |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.