Protein Family IF10161

Metagenome Isolate
154 Members
50 Samples
148 Scaffolds
130.6 Avg Length

🧬 Representative Sequence

ID
3300042655|Ga0466727_198706|Ga0466727_198706_893_1336
Length
147 aa
Sequence
MRAYDRTHKSNRGQSPMKYLVDTHILLWSFIEPEKLSDNIGKLLLDEDNDIYYSPINLWEISIKYGLKKLELKRLTPEAFYTELENSYYLCKEVNNEDLITNYKLPVFHKDPFDRFLIWEAIRNDFIFMSVDDNMKLYRKDGLKVIY

📊 Sample Types

Isolate 3.9%
Metagenome 96.1%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 52.1%
Kalotermitidae 22.9%
Unclassified 14.6%
Rhinotermitidae 6.2%
Termopsidae 4.2%

🌳 Taxonomy

Archaea 1
Bacteria 138
Eukaryota 0
Viruses 0
Unclassified 15

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2820741847 Unclassified Bacteroidetes Th196P3bin71 Isolate Unclassified
2 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
3 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
4 3300041968 Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 Metagenome Rhinotermitidae
5 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
6 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
7 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
8 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
9 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
10 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
11 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
12 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
13 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
14 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
15 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
16 2820201435 Unclassified Planctomycetes Cu122P5bin25 Isolate Unclassified
17 2820570671 Unclassified Firmicutes Emb289P3bin19 Isolate Unclassified
18 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
19 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
20 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
21 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
22 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
23 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
24 2820223845 Unclassified Firmicutes Th196P4bin57 Isolate Unclassified
25 3300001880 Termite hindgut microbial communities from the Max Planck Institute, Bremen, Germany, analyzing fibers in the hindgut lumen - ASSEMBLED Fiber-Associated Metagenome Metagenome
26 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
27 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
28 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
29 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
30 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
31 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
32 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
33 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
34 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
35 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
36 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
37 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
38 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
39 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
40 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
41 650716102 Treponema primitia ZAS-2 Isolate Unclassified
42 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
43 2820255904 Unclassified Firmicutes Th196P3bin48 Isolate Unclassified
44 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
45 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
46 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
47 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
48 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
49 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
50 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466726_156855 3300042619 Bacteria 2151
2 Ga0466729_007794 3300042621 Bacteria 2298
3 Ga0123355_10646437 3300009826 Bacteria 1236
4 Ga0123356_10045087 3300010049 Bacteria 4104
5 Ga0123356_12006168 3300010049 Unclassified 722
6 Ga0123353_10732654 3300010167 Bacteria 1380
7 Ga0123353_10977947 3300010167 Bacteria 1140
8 Ga0123353_10996153 3300010167 Bacteria 1127
9 Ga0123353_11014032 3300010167 Bacteria 1114
10 Ga0415639_036057 3300038395 Bacteria 21086
11 Ga0415639_052096 3300038395 Bacteria 2225
12 Ga0456237_0035987 3300041968 Unclassified 658
13 Ga0466690_205181 3300042590 Bacteria 2787
14 Ga0466727_084282 3300042655 Bacteria 3391
15 Ga0466727_317535 3300042655 Bacteria 1513
16 Ga0466700_361800 3300042600 Bacteria 1128
17 Ga0466697_048634 3300042611 Bacteria 1430
18 AustNasuHG_c1014842 3300000089 Bacteria 2638
19 FAAS_10668269 3300001880 Bacteria 501
20 JGI24696J40584_12694684 3300002834 Bacteria 732
21 Ga0072940_1012494 3300005200 Bacteria 1868
22 Ga0466726_126547 3300042619 Bacteria 1148
23 Ga0123357_10320224 3300009784 Bacteria 1533
24 Ga0123355_10199481 3300009826 Bacteria 2927
25 Ga0123356_11637684 3300010049 Bacteria 797
26 Ga0123356_12804617 3300010049 Bacteria 610
27 Ga0123356_13853140 3300010049 Bacteria 518
28 Ga0123353_10198655 3300010167 Bacteria 3158
29 Ga0123353_10360375 3300010167 Unclassified 2185
30 Ga0123353_10571579 3300010167 Unclassified 1625
31 Ga0123353_10681656 3300010167 Bacteria 1447
32 Ga0123353_12362436 3300010167 Bacteria 637
33 Ga0123353_13319072 3300010167 Bacteria 513
34 Ga0466691_118900 3300042593 Bacteria 1580
35 Ga0466694_104421 3300042594 Bacteria 1810
36 Ga0466703_070257 3300042636 Bacteria 1375
37 Ga0466709_326868 3300042648 Bacteria 1766
38 Ga0466725_449796 3300042654 Bacteria 1088
39 Ga0466727_065326 3300042655 Bacteria 1513
40 Ga0466721_207123 3300042608 Bacteria 7622
41 AustNasuHG_c1012796 3300000089 Bacteria 2890
42 JGI24698J34947_10007819 3300002449 Bacteria 5873
43 JGI24695J34938_10025658 3300002450 Bacteria 2814
44 JGI24702J35022_10038389 3300002462 Unclassified 2557
45 Ga0466726_050634 3300042619 Bacteria 1512
46 Ga0466726_159940 3300042619 Bacteria 1052
47 Ga0466726_475178 3300042619 Bacteria 1182
48 Ga0466729_114115 3300042621 Unclassified 2477
49 Ga0123353_11870534 3300010167 Unclassified 742
50 Ga0123354_10720322 3300010882 Bacteria 692
51 Ga0415639_026262 3300038395 Bacteria 11018
52 Ga0415639_071835 3300038395 Bacteria 1540
53 Ga0415639_160227 3300038395 Bacteria 1163
54 Ga0466727_274171 3300042655 Bacteria 1740
55 Ga0466701_089959 3300042598 Bacteria 1441
56 Ga0466707_362923 3300042601 Bacteria 1194
57 Ga0466719_065538 3300042606 Bacteria 3326
58 Ga0466721_184247 3300042608 Bacteria 1747
59 Ga0466722_026736 3300042609 Bacteria 2306
60 Ga0466722_127992 3300042609 Bacteria 1243
61 JGI24696J40584_12957487 3300002834 Unclassified 3539
62 Ga0072940_1014379 3300005200 Bacteria 2499
63 Ga0466712_065151 3300042614 Bacteria 1336
64 Ga0466712_088906 3300042614 Bacteria 5711
65 Ga0466711_132793 3300042615 Bacteria 3391
66 Ga0466715_213163 3300042616 Bacteria 1021
67 Ga0466726_472629 3300042619 Bacteria 1467
68 Ga0466726_476535 3300042619 Bacteria 4782
69 Ga0123355_10058903 3300009826 Bacteria 6210
70 Ga0123353_10313521 3300010167 Bacteria 2385
71 Ga0123354_10791935 3300010882 Bacteria 640
72 Ga0466704_059180 3300042643 Bacteria 1048
73 Ga0466708_088633 3300042652 Bacteria 3651
74 Ga0466727_227106 3300042655 Bacteria 10483
75 Ga0466719_145153 3300042606 Bacteria 1558
76 JGI24695J34938_10009480 3300002450 Bacteria 5412
77 Ga0466697_272440 3300042611 Bacteria 2186
78 Ga0466711_112003 3300042615 Bacteria 1285
79 Ga0466726_093269 3300042619 Bacteria 5970
80 Ga0123355_10246753 3300009826 Unclassified 2520
81 Ga0123356_10000207 3300010049 Bacteria 68372
82 Ga0123356_10089353 3300010049 Bacteria 2931
83 Ga0123356_10141892 3300010049 Bacteria 2371
84 Ga0123353_10183792 3300010167 Unclassified 3307
85 Ga0123353_10265990 3300010167 Bacteria 2645
86 Ga0123353_10413895 3300010167 Bacteria 2000
87 Ga0123353_11048056 3300010167 Bacteria 1090
88 Ga0123354_10134952 3300010882 Bacteria 3092
89 Ga0466696_011542 3300042596 Bacteria 2556
90 Ga0466708_246885 3300042652 Bacteria 2375
91 Ga0466727_306906 3300042655 Bacteria 1094
92 Ga0466719_296977 3300042606 Bacteria 3387
93 Ga0466720_135304 3300042607 Bacteria 3572
94 Ga0466721_319775 3300042608 Bacteria 2912
95 Ga0466722_138401 3300042609 Bacteria 4736
96 JGI24696J40584_12620649 3300002834 Bacteria 671
97 Ga0466726_293206 3300042619 Bacteria 1115
98 Ga0123355_10080064 3300009826 Bacteria 5216
99 Ga0123355_10455418 3300009826 Bacteria 1609
100 Ga0123355_11001938 3300009826 Bacteria 887
101 Ga0123356_10271097 3300010049 Unclassified 1787
102 Ga0123356_11735507 3300010049 Bacteria 775
103 Ga0123353_10079936 3300010167 Bacteria 5258
104 Ga0123353_11519516 3300010167 Bacteria 851
105 Ga0123353_12536574 3300010167 Bacteria 609
106 Ga0123354_10807867 3300010882 Bacteria 631
107 Ga0264413_112515 3300024493 Bacteria 3341
108 Ga0466701_071462 3300042598 Bacteria 1013
109 JGI24695J34938_10048206 3300002450 Bacteria 1877
110 Ga0466718_166247 3300042617 Bacteria 1088
111 Ga0466726_443996 3300042619 Bacteria 2272
112 Ga0123353_10251967 3300010167 Bacteria 2734
113 Ga0123353_10298088 3300010167 Bacteria 2463
114 Ga0123353_10703810 3300010167 Bacteria 1417
115 Ga0123353_11802399 3300010167 Bacteria 760
116 Ga0123353_12027948 3300010167 Unclassified 704
117 Ga0123354_10000197 3300010882 Bacteria 51729
118 Ga0123354_10820626 3300010882 Bacteria 623
119 Ga0466696_057605 3300042596 Bacteria 5810
120 Ga0466703_000978 3300042636 Bacteria 2895
121 Ga0466709_174596 3300042648 Bacteria 6760
122 Ga0466727_198706 3300042655 Bacteria 2027
123 Ga0466722_019608 3300042609 Bacteria 2591
124 AustNasuHG_c1027942 3300000089 Unclassified 1702
125 JGI24695J34938_10041525 3300002450 Bacteria 2065
126 JGI24695J34938_10047860 3300002450 Bacteria 1886
127 JGI24702J35022_10002384 3300002462 Bacteria 11496
128 JGI24705J35276_12092755 3300002504 Bacteria 999
129 Ga0466705_484457 3300042612 Bacteria 1000
130 Ga0123356_10876704 3300010049 Bacteria 1069
131 Ga0123356_11120516 3300010049 Unclassified 955
132 Ga0123356_11629817 3300010049 Bacteria 799
133 Ga0123356_11678250 3300010049 Bacteria 788
134 Ga0123353_10122636 3300010167 Bacteria 4177
135 Ga0123353_10352028 3300010167 Bacteria 2218
136 Ga0123353_10953625 3300010167 Bacteria 1160
137 Ga0123353_11074906 3300010167 Bacteria 1072
138 Ga0123353_12242781 3300010167 Unclassified 659
139 Ga0123354_10508211 3300010882 Bacteria 934
140 Ga0264413_127777 3300024493 Bacteria 2024
141 Ga0466657_303462 3300042582 Archaea 1512
142 Ga0466699_233166 3300042597 Bacteria 6329
143 Ga0466727_261325 3300042655 Bacteria 1128
144 Ga0466719_421803 3300042606 Bacteria 1282
145 Ga0466720_040019 3300042607 Bacteria 2635
146 Ga0466698_056907 3300042610 Bacteria 1679
147 JGI24702J35022_10025821 3300002462 Bacteria 3167
148 JGI24705J35276_12182489 3300002504 Bacteria 1382

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300010049 Ga0123356_12006168 Ga0123356_120061681 118
2 3300042621 Ga0466729_114115 Ga0466729_114115_293_655 120
3 3300010882 Ga0123354_10134952 Ga0123354_101349523 123
4 3300042597 Ga0466699_233166 Ga0466699_233166_3770_4141 123
5 3300042619 Ga0466726_293206 Ga0466726_293206_13_390 125
6 3300038395 Ga0415639_052096 Ga0415639_052096_1116_1496 126
7 3300042609 Ga0466722_019608 Ga0466722_019608_892_1272 126
8 3300042609 Ga0466722_127992 Ga0466722_127992_700_1080 126
9 3300010049 Ga0123356_11678250 Ga0123356_116782502 127
10 3300010049 Ga0123356_11735507 Ga0123356_117355072 127
11 3300010167 Ga0123353_10571579 Ga0123353_105715793 127
12 3300010167 Ga0123353_10703810 Ga0123353_107038103 127
13 3300010167 Ga0123353_11074906 Ga0123353_110749062 127
14 3300042607 Ga0466720_135304 Ga0466720_135304_2728_3111 127
15 3300042608 Ga0466721_207123 Ga0466721_207123_1525_1908 127
16 3300042608 Ga0466721_319775 Ga0466721_319775_1017_1400 127
17 iso_pr_bacteria 2820223845 2820227058 127
18 iso_pr_bacteria 2820255904 2820256406 127
19 3300002462 JGI24702J35022_10038389 JGI24702J35022_100383892 128
20 3300009784 Ga0123357_10320224 Ga0123357_103202242 128
21 3300009826 Ga0123355_10058903 Ga0123355_100589033 128
22 3300009826 Ga0123355_10080064 Ga0123355_100800643 128
23 3300009826 Ga0123355_10199481 Ga0123355_101994814 128
24 3300009826 Ga0123355_10246753 Ga0123355_102467533 128
25 3300009826 Ga0123355_10455418 Ga0123355_104554182 128
26 3300009826 Ga0123355_10646437 Ga0123355_106464372 128
27 3300010167 Ga0123353_10183792 Ga0123353_101837922 128
28 3300010882 Ga0123354_10720322 Ga0123354_107203222 128
29 3300038395 Ga0415639_026262 Ga0415639_026262_8274_8660 128
30 3300038395 Ga0415639_071835 Ga0415639_071835_393_779 128
31 3300038395 Ga0415639_160227 Ga0415639_160227_53_439 128
32 3300041968 Ga0456237_0035987 Ga0456237_0035987_205_591 128
33 3300042594 Ga0466694_104421 Ga0466694_104421_429_815 128
34 3300002462 JGI24702J35022_10002384 JGI24702J35022_100023846 129
35 3300002834 JGI24696J40584_12620649 JGI24696J40584_126206492 129
36 3300002834 JGI24696J40584_12694684 JGI24696J40584_126946841 129
37 3300002834 JGI24696J40584_12957487 JGI24696J40584_129574873 129
38 3300009826 Ga0123355_11001938 Ga0123355_110019382 129
39 3300010049 Ga0123356_10045087 Ga0123356_100450872 129
40 3300010049 Ga0123356_10141892 Ga0123356_101418923 129
41 3300010049 Ga0123356_10876704 Ga0123356_108767042 129
42 3300010049 Ga0123356_11120516 Ga0123356_111205162 129
43 3300010049 Ga0123356_11637684 Ga0123356_116376842 129
44 3300010167 Ga0123353_10079936 Ga0123353_100799363 129
45 3300010167 Ga0123353_10122636 Ga0123353_101226362 129
46 3300010167 Ga0123353_10251967 Ga0123353_102519673 129
47 3300010167 Ga0123353_10265990 Ga0123353_102659903 129
48 3300010167 Ga0123353_10298088 Ga0123353_102980883 129
49 3300010167 Ga0123353_10313521 Ga0123353_103135213 129
50 3300010167 Ga0123353_10352028 Ga0123353_103520282 129
51 3300010167 Ga0123353_10360375 Ga0123353_103603753 129
52 3300010167 Ga0123353_10413895 Ga0123353_104138952 129
53 3300010167 Ga0123353_10681656 Ga0123353_106816563 129
54 3300010167 Ga0123353_10732654 Ga0123353_107326544 129
55 3300010167 Ga0123353_10977947 Ga0123353_109779472 129
56 3300010167 Ga0123353_10996153 Ga0123353_109961532 129
57 3300010167 Ga0123353_11014032 Ga0123353_110140322 129
58 3300010167 Ga0123353_11048056 Ga0123353_110480563 129
59 3300010167 Ga0123353_11519516 Ga0123353_115195161 129
60 3300010167 Ga0123353_11802399 Ga0123353_118023992 129
61 3300010167 Ga0123353_12027948 Ga0123353_120279482 129
62 3300010167 Ga0123353_12242781 Ga0123353_122427811 129
63 3300010167 Ga0123353_12362436 Ga0123353_123624361 129
64 3300010167 Ga0123353_12536574 Ga0123353_125365742 129
65 3300010167 Ga0123353_13319072 Ga0123353_133190721 129
66 3300010882 Ga0123354_10508211 Ga0123354_105082112 129
67 3300010882 Ga0123354_10791935 Ga0123354_107919351 129
68 3300010882 Ga0123354_10807867 Ga0123354_108078671 129
69 3300010882 Ga0123354_10820626 Ga0123354_108206261 129
70 3300042608 Ga0466721_184247 Ga0466721_184247_273_662 129
71 3300042596 Ga0466696_011542 Ga0466696_011542_267_659 130
72 3300024493 Ga0264413_112515 Ga0264413_1125153 131
73 3300024493 Ga0264413_127777 Ga0264413_1277771 131
74 3300038395 Ga0415639_036057 Ga0415639_036057_1313_1708 131
75 3300042582 Ga0466657_303462 Ga0466657_303462_752_1147 131
76 3300042590 Ga0466690_205181 Ga0466690_205181_1240_1635 131
77 3300042593 Ga0466691_118900 Ga0466691_118900_170_565 131
78 3300042596 Ga0466696_057605 Ga0466696_057605_786_1181 131
79 3300042598 Ga0466701_071462 Ga0466701_071462_539_934 131
80 3300042598 Ga0466701_089959 Ga0466701_089959_442_837 131
81 3300042601 Ga0466707_362923 Ga0466707_362923_435_830 131
82 3300042606 Ga0466719_065538 Ga0466719_065538_2615_3010 131
83 3300042606 Ga0466719_145153 Ga0466719_145153_389_784 131
84 3300042606 Ga0466719_421803 Ga0466719_421803_81_476 131
85 3300042607 Ga0466720_040019 Ga0466720_040019_518_913 131
86 3300042609 Ga0466722_026736 Ga0466722_026736_1251_1646 131
87 3300042609 Ga0466722_138401 Ga0466722_138401_1578_1973 131
88 3300042610 Ga0466698_056907 Ga0466698_056907_212_607 131
89 3300042614 Ga0466712_065151 Ga0466712_065151_841_1236 131
90 3300042614 Ga0466712_088906 Ga0466712_088906_546_941 131
91 3300042615 Ga0466711_112003 Ga0466711_112003_600_995 131
92 3300042615 Ga0466711_132793 Ga0466711_132793_1953_2348 131
93 3300042616 Ga0466715_213163 Ga0466715_213163_332_727 131
94 3300042617 Ga0466718_166247 Ga0466718_166247_622_1017 131
95 3300042619 Ga0466726_050634 Ga0466726_050634_284_679 131
96 3300042619 Ga0466726_093269 Ga0466726_093269_1161_1556 131
97 3300042619 Ga0466726_126547 Ga0466726_126547_30_425 131
98 3300042619 Ga0466726_443996 Ga0466726_443996_449_844 131
99 3300042619 Ga0466726_472629 Ga0466726_472629_960_1355 131
100 3300042619 Ga0466726_475178 Ga0466726_475178_107_502 131
101 3300042619 Ga0466726_476535 Ga0466726_476535_3823_4218 131
102 3300042621 Ga0466729_007794 Ga0466729_007794_670_1065 131
103 3300042636 Ga0466703_000978 Ga0466703_000978_1796_2191 131
104 3300042636 Ga0466703_070257 Ga0466703_070257_73_468 131
105 3300042643 Ga0466704_059180 Ga0466704_059180_358_753 131
106 3300042648 Ga0466709_174596 Ga0466709_174596_1022_1417 131
107 3300042648 Ga0466709_326868 Ga0466709_326868_1133_1528 131
108 3300042652 Ga0466708_088633 Ga0466708_088633_2489_2884 131
109 3300042655 Ga0466727_065326 Ga0466727_065326_55_450 131
110 3300042655 Ga0466727_084282 Ga0466727_084282_2192_2587 131
111 3300042655 Ga0466727_227106 Ga0466727_227106_3104_3499 131
112 3300042655 Ga0466727_261325 Ga0466727_261325_673_1068 131
113 3300042655 Ga0466727_274171 Ga0466727_274171_965_1360 131
114 3300042655 Ga0466727_306906 Ga0466727_306906_151_546 131
115 3300042655 Ga0466727_317535 Ga0466727_317535_235_630 131
116 iso_pr_bacteria 2820570671 2820572278 131
117 iso_pr_bacteria 2820741847 2820742855 131
118 iso_pr_bacteria 650716102 650880825 131
119 3300000089 AustNasuHG_c1012796 AustNasuHG_10127962 132
120 3300000089 AustNasuHG_c1014842 AustNasuHG_10148423 132
121 3300000089 AustNasuHG_c1027942 AustNasuHG_10279422 132
122 3300001880 FAAS_10668269 FAAS_106682692 132
123 3300002449 JGI24698J34947_10007819 JGI24698J34947_100078193 132
124 3300002450 JGI24695J34938_10009480 JGI24695J34938_100094804 132
125 3300002450 JGI24695J34938_10025658 JGI24695J34938_100256581 132
126 3300002450 JGI24695J34938_10041525 JGI24695J34938_100415252 132
127 3300002450 JGI24695J34938_10047860 JGI24695J34938_100478603 132
128 3300002504 JGI24705J35276_12092755 JGI24705J35276_120927551 132
129 3300002504 JGI24705J35276_12182489 JGI24705J35276_121824892 132
130 3300005200 Ga0072940_1012494 Ga0072940_10124941 132
131 3300005200 Ga0072940_1014379 Ga0072940_10143795 132
132 3300010049 Ga0123356_10000207 Ga0123356_1000020734 132
133 3300010882 Ga0123354_10000197 Ga0123354_1000019713 132
134 3300042611 Ga0466697_048634 Ga0466697_048634_519_917 132
135 3300042611 Ga0466697_272440 Ga0466697_272440_1173_1571 132
136 3300042654 Ga0466725_449796 Ga0466725_449796_280_678 132
137 iso_pr_bacteria 2820201435 2820201790 132
138 3300010049 Ga0123356_10089353 Ga0123356_100893533 133
139 3300010049 Ga0123356_10271097 Ga0123356_102710971 133
140 3300010049 Ga0123356_13853140 Ga0123356_138531401 133
141 3300010167 Ga0123353_11870534 Ga0123353_118705341 133
142 3300042612 Ga0466705_484457 Ga0466705_484457_392_793 133
143 3300010049 Ga0123356_11629817 Ga0123356_116298172 134
144 3300010167 Ga0123353_10953625 Ga0123353_109536253 136
145 3300042600 Ga0466700_361800 Ga0466700_361800_46_456 136
146 3300042619 Ga0466726_159940 Ga0466726_159940_512_922 136
147 3300002462 JGI24702J35022_10025821 JGI24702J35022_100258212 137
148 3300010049 Ga0123356_12804617 Ga0123356_128046172 137
149 3300002450 JGI24695J34938_10048206 JGI24695J34938_100482062 139
150 3300042652 Ga0466708_246885 Ga0466708_246885_701_1123 140
151 3300010167 Ga0123353_10198655 Ga0123353_101986555 144
152 3300042606 Ga0466719_296977 Ga0466719_296977_980_1420 146
153 3300042655 Ga0466727_198706 Ga0466727_198706_893_1336 147
154 3300042619 Ga0466726_156855 Ga0466726_156855_1590_2105 171

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF01850 PIN PIN domain 19 138 0.84

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.88 0.91 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.