Protein Family IF10137
Metagenome
Isolate
242
Members
49
Samples
236
Scaffolds
368.09
Avg Length
Representative Sequence
- ID
- 3300042655|Ga0466727_094611|Ga0466727_094611_167_1378
- Length
- 403 aa
- Sequence
- MKLPRLNRSFFADNAVVIIFIVITGAAAPISGLSPISIIQEIFTRIGRNCFLVFSLILPIMAGMGINFGMVLGAMAGQIGLVFTVDWNIVGVPGLHFASLIAIPIAAGLGWIAGQILNRARGREMVTGYVLGFFMDGFYQFVVLYLMGQPAIWTAKVLYRWTALIPIHSPTIILSRGYGIRNTLPLDTVRQSLDKFIPLTIGPFATPFPGANGAPFVFGPISIPVMNYLVIGLLCLFIIWFRKTKLGQDMRAVGQNQAVAHAAGIPVDRTRILAIVISTVLASLGQIIFLQNMGNIATYNAHQQTGFMAAAAILVGGASVSKASIPNVFIGTMLLHLMYIVVPRAGANLFGDAQIGEYFRDAFSYAIIALALVIHAWRKRAQAEAARSTLRGGTTVENEEAAV
Sample Types
Isolate
2.5%
Metagenome
97.5%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
35.4%
Kalotermitidae
29.2%
Unclassified
16.7%
Termopsidae
8.3%
Rhinotermitidae
8.3%
Blaberidae
2.1%
Taxonomy
Archaea
0
Bacteria
205
Eukaryota
0
Viruses
0
Unclassified
37
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2781125652 | Treponema sp. Cu122P5bin1 | Isolate | Unclassified |
| 2 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 3 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 4 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 5 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 6 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 7 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 8 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 9 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 10 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 11 | 2781125696 | Treponema sp. Th196P4bin22 | Isolate | Unclassified |
| 12 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 13 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 14 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 15 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 16 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 17 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 18 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 19 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 20 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 21 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 22 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 23 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 24 | 2772190975 | Treponema sp. RmG30 | Isolate | Blaberidae |
| 25 | 3300005485 | Termite gut microbial communities from Costa Rica - P3 luminal contents | Metagenome | Termitidae |
| 26 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 27 | 650716099 | Leadbettera azotonutricia ZAS-9 | Isolate | Unclassified |
| 28 | 650716102 | Treponema primitia ZAS-2 | Isolate | Unclassified |
| 29 | 2781125697 | Treponema sp. Th196P4bin17 | Isolate | Unclassified |
| 30 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 31 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 32 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 33 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 34 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 35 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 36 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 37 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 38 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 39 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 40 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 41 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 42 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 43 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 44 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 45 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 46 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 47 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 48 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 49 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_266113 | 3300042612 | Bacteria | 67009 |
| 2 | Ga0466733_141574 | 3300042659 | Bacteria | 39609 |
| 3 | Ga0466694_280929 | 3300042594 | Bacteria | 2340 |
| 4 | Ga0466707_226452 | 3300042601 | Bacteria | 1648 |
| 5 | Ga0466716_408761 | 3300042605 | Bacteria | 2944 |
| 6 | Ga0466720_070981 | 3300042607 | Unclassified | 2616 |
| 7 | Ga0466729_250848 | 3300042621 | Bacteria | 7728 |
| 8 | Ga0466703_293984 | 3300042636 | Bacteria | 3107 |
| 9 | Ga0466704_012134 | 3300042643 | Bacteria | 32013 |
| 10 | Ga0466704_495999 | 3300042643 | Unclassified | 6307 |
| 11 | Ga0466709_226962 | 3300042648 | Unclassified | 10600 |
| 12 | Ga0466709_292005 | 3300042648 | Bacteria | 2254 |
| 13 | Ga0466708_062043 | 3300042652 | Bacteria | 7554 |
| 14 | Ga0466727_271270 | 3300042655 | Bacteria | 2406 |
| 15 | Ga0466705_479762 | 3300042612 | Unclassified | 2847 |
| 16 | Ga0466712_178679 | 3300042614 | Bacteria | 10236 |
| 17 | Ga0466711_194109 | 3300042615 | Bacteria | 7522 |
| 18 | Ga0466711_364659 | 3300042615 | Bacteria | 14297 |
| 19 | Ga0466715_072961 | 3300042616 | Bacteria | 6397 |
| 20 | Ga0466715_259750 | 3300042616 | Bacteria | 18031 |
| 21 | Ga0466718_029225 | 3300042617 | Bacteria | 2593 |
| 22 | Ga0466723_004479 | 3300042618 | Bacteria | 9421 |
| 23 | Ga0466726_044422 | 3300042619 | Bacteria | 32261 |
| 24 | Ga0466726_050726 | 3300042619 | Bacteria | 6913 |
| 25 | Ga0466726_381806 | 3300042619 | Bacteria | 3652 |
| 26 | Ga0466728_380881 | 3300042620 | Bacteria | 39953 |
| 27 | Ga0466705_044654 | 3300042612 | Bacteria | 9097 |
| 28 | Ga0466732_182246 | 3300042656 | Bacteria | 2282 |
| 29 | Ga0466733_081493 | 3300042659 | Bacteria | 4042 |
| 30 | Ga0466733_089635 | 3300042659 | Unclassified | 3488 |
| 31 | Ga0466690_333302 | 3300042590 | Bacteria | 14368 |
| 32 | Ga0466691_121825 | 3300042593 | Bacteria | 10967 |
| 33 | Ga0466696_081603 | 3300042596 | Bacteria | 18095 |
| 34 | Ga0466696_371476 | 3300042596 | Bacteria | 6887 |
| 35 | Ga0123353_10100971 | 3300010167 | Bacteria | 4651 |
| 36 | Ga0466716_094917 | 3300042605 | Bacteria | 4180 |
| 37 | Ga0466716_298274 | 3300042605 | Bacteria | 4885 |
| 38 | Ga0466719_225373 | 3300042606 | Bacteria | 49819 |
| 39 | Ga0466720_099228 | 3300042607 | Bacteria | 1944 |
| 40 | AustNasuHG_c1031718 | 3300000089 | Unclassified | 1485 |
| 41 | JGI24698J34947_10041223 | 3300002449 | Unclassified | 2379 |
| 42 | JGI24702J35022_10007047 | 3300002462 | Bacteria | 6457 |
| 43 | Ga0074263_106685 | 3300005485 | Bacteria | 4224 |
| 44 | Ga0074263_110271 | 3300005485 | Unclassified | 3488 |
| 45 | Ga0466704_196377 | 3300042643 | Bacteria | 9020 |
| 46 | Ga0466709_240212 | 3300042648 | Bacteria | 5619 |
| 47 | Ga0466708_061435 | 3300042652 | Bacteria | 15050 |
| 48 | Ga0466712_077756 | 3300042614 | Unclassified | 2736 |
| 49 | Ga0466715_291716 | 3300042616 | Bacteria | 4515 |
| 50 | Ga0466715_458842 | 3300042616 | Bacteria | 4980 |
| 51 | Ga0466718_027425 | 3300042617 | Bacteria | 17561 |
| 52 | Ga0466723_145478 | 3300042618 | Bacteria | 8940 |
| 53 | Ga0466723_311378 | 3300042618 | Bacteria | 14066 |
| 54 | Ga0466728_161663 | 3300042620 | Bacteria | 6025 |
| 55 | Ga0264413_116220 | 3300024493 | Bacteria | 7104 |
| 56 | Ga0466690_111046 | 3300042590 | Bacteria | 7005 |
| 57 | Ga0466692_038145 | 3300042591 | Bacteria | 15454 |
| 58 | Ga0466692_063053 | 3300042591 | Bacteria | 5739 |
| 59 | Ga0466691_164175 | 3300042593 | Unclassified | 8423 |
| 60 | Ga0466691_172104 | 3300042593 | Bacteria | 8819 |
| 61 | Ga0123353_10006277 | 3300010167 | Bacteria | 15798 |
| 62 | Ga0466717_293120 | 3300042604 | Bacteria | 1544 |
| 63 | Ga0466716_245286 | 3300042605 | Bacteria | 4293 |
| 64 | Ga0466719_398114 | 3300042606 | Unclassified | 2080 |
| 65 | Ga0466720_160082 | 3300042607 | Bacteria | 4225 |
| 66 | Ga0466722_047401 | 3300042609 | Bacteria | 2150 |
| 67 | Ga0466722_160996 | 3300042609 | Bacteria | 18974 |
| 68 | JGI24702J35022_10060837 | 3300002462 | Unclassified | 2019 |
| 69 | Ga0466735_235066 | 3300042624 | Bacteria | 22324 |
| 70 | Ga0466703_034327 | 3300042636 | Bacteria | 6856 |
| 71 | Ga0466703_147002 | 3300042636 | Bacteria | 25312 |
| 72 | Ga0466704_228543 | 3300042643 | Bacteria | 21203 |
| 73 | Ga0466704_328715 | 3300042643 | Bacteria | 2618 |
| 74 | Ga0466727_133070 | 3300042655 | Bacteria | 1329 |
| 75 | Ga0466712_023838 | 3300042614 | Bacteria | 27673 |
| 76 | Ga0466711_047053 | 3300042615 | Bacteria | 30744 |
| 77 | Ga0466711_251557 | 3300042615 | Bacteria | 7097 |
| 78 | Ga0466715_001364 | 3300042616 | Bacteria | 11977 |
| 79 | Ga0466715_070028 | 3300042616 | Unclassified | 2906 |
| 80 | Ga0466705_053740 | 3300042612 | Bacteria | 6375 |
| 81 | Ga0466705_343591 | 3300042612 | Bacteria | 7988 |
| 82 | Ga0466733_040614 | 3300042659 | Unclassified | 2896 |
| 83 | Ga0466691_196180 | 3300042593 | Bacteria | 16526 |
| 84 | Ga0466716_134351 | 3300042605 | Bacteria | 9093 |
| 85 | Ga0466719_028622 | 3300042606 | Bacteria | 29457 |
| 86 | Ga0466720_117055 | 3300042607 | Bacteria | 4504 |
| 87 | Ga0466720_228476 | 3300042607 | Bacteria | 22751 |
| 88 | Ga0466722_073962 | 3300042609 | Bacteria | 10258 |
| 89 | Ga0466722_196308 | 3300042609 | Bacteria | 30459 |
| 90 | AustNasuHG_c1000250 | 3300000089 | Bacteria | 18173 |
| 91 | Ga0072940_1009974 | 3300005200 | Bacteria | 7157 |
| 92 | Ga0466703_102834 | 3300042636 | Bacteria | 50101 |
| 93 | Ga0466703_142695 | 3300042636 | Bacteria | 5432 |
| 94 | Ga0466703_177637 | 3300042636 | Bacteria | 197398 |
| 95 | Ga0466704_092724 | 3300042643 | Bacteria | 21710 |
| 96 | Ga0466704_267557 | 3300042643 | Bacteria | 5612 |
| 97 | Ga0466704_616253 | 3300042643 | Bacteria | 5691 |
| 98 | Ga0466708_067510 | 3300042652 | Bacteria | 3191 |
| 99 | Ga0466708_069512 | 3300042652 | Bacteria | 3986 |
| 100 | Ga0466708_144170 | 3300042652 | Unclassified | 11029 |
| 101 | Ga0466708_255089 | 3300042652 | Unclassified | 4455 |
| 102 | Ga0466712_063934 | 3300042614 | Bacteria | 13931 |
| 103 | Ga0466718_053482 | 3300042617 | Bacteria | 6445 |
| 104 | Ga0466726_212284 | 3300042619 | Bacteria | 3598 |
| 105 | Ga0466728_058193 | 3300042620 | Bacteria | 2641 |
| 106 | Ga0466705_251698 | 3300042612 | Bacteria | 2696 |
| 107 | Ga0264413_107585 | 3300024493 | Bacteria | 6060 |
| 108 | Ga0466690_328723 | 3300042590 | Unclassified | 2018 |
| 109 | Ga0466691_025724 | 3300042593 | Bacteria | 8952 |
| 110 | Ga0466691_117882 | 3300042593 | Bacteria | 10489 |
| 111 | Ga0466691_160942 | 3300042593 | Bacteria | 4828 |
| 112 | Ga0466694_295107 | 3300042594 | Bacteria | 1797 |
| 113 | Ga0466694_298657 | 3300042594 | Bacteria | 3863 |
| 114 | Ga0466694_298861 | 3300042594 | Bacteria | 3938 |
| 115 | Ga0466696_173173 | 3300042596 | Bacteria | 8250 |
| 116 | Ga0466696_260461 | 3300042596 | Bacteria | 2228 |
| 117 | Ga0466696_294198 | 3300042596 | Bacteria | 9197 |
| 118 | Ga0466699_223938 | 3300042597 | Bacteria | 2786 |
| 119 | Ga0466699_227803 | 3300042597 | Bacteria | 20734 |
| 120 | Ga0123353_10233587 | 3300010167 | Bacteria | 2864 |
| 121 | Ga0466713_020839 | 3300042602 | Bacteria | 4853 |
| 122 | Ga0466716_124843 | 3300042605 | Bacteria | 14158 |
| 123 | Ga0466716_129539 | 3300042605 | Bacteria | 7144 |
| 124 | Ga0466720_144749 | 3300042607 | Unclassified | 3855 |
| 125 | Ga0466722_080187 | 3300042609 | Bacteria | 9094 |
| 126 | Ga0072940_1020634 | 3300005200 | Unclassified | 9906 |
| 127 | Ga0466703_050312 | 3300042636 | Bacteria | 5784 |
| 128 | Ga0466704_025192 | 3300042643 | Bacteria | 4281 |
| 129 | Ga0466704_108428 | 3300042643 | Bacteria | 12073 |
| 130 | Ga0466709_351522 | 3300042648 | Bacteria | 13513 |
| 131 | Ga0466708_035859 | 3300042652 | Bacteria | 41234 |
| 132 | Ga0466708_184900 | 3300042652 | Bacteria | 8250 |
| 133 | Ga0466708_285346 | 3300042652 | Bacteria | 1827 |
| 134 | Ga0466712_025557 | 3300042614 | Bacteria | 17046 |
| 135 | Ga0466715_450609 | 3300042616 | Bacteria | 2276 |
| 136 | Ga0466718_095801 | 3300042617 | Bacteria | 8841 |
| 137 | Ga0466718_105747 | 3300042617 | Unclassified | 7470 |
| 138 | Ga0466723_060560 | 3300042618 | Bacteria | 5183 |
| 139 | Ga0466726_002459 | 3300042619 | Bacteria | 1946 |
| 140 | Ga0466726_271916 | 3300042619 | Bacteria | 2553 |
| 141 | Ga0466728_243978 | 3300042620 | Bacteria | 6451 |
| 142 | Ga0466705_226278 | 3300042612 | Bacteria | 5584 |
| 143 | Ga0466732_404051 | 3300042656 | Unclassified | 1050 |
| 144 | Ga0466733_071037 | 3300042659 | Unclassified | 1022 |
| 145 | Ga0466733_213350 | 3300042659 | Bacteria | 4312 |
| 146 | Ga0466690_227917 | 3300042590 | Unclassified | 6111 |
| 147 | Ga0466692_144954 | 3300042591 | Bacteria | 19772 |
| 148 | Ga0466691_037708 | 3300042593 | Bacteria | 9878 |
| 149 | Ga0466696_130083 | 3300042596 | Bacteria | 16017 |
| 150 | Ga0466707_375294 | 3300042601 | Bacteria | 3456 |
| 151 | Ga0466714_156182 | 3300042603 | Bacteria | 4599 |
| 152 | Ga0466722_066251 | 3300042609 | Bacteria | 2275 |
| 153 | Ga0466698_362288 | 3300042610 | Bacteria | 1997 |
| 154 | JGI24702J35022_10022195 | 3300002462 | Bacteria | 3438 |
| 155 | Ga0068302_10010721 | 3300005071 | Bacteria | 2258 |
| 156 | Ga0068305_10241988 | 3300005083 | Bacteria | 9268 |
| 157 | Ga0072940_1033817 | 3300005200 | Bacteria | 3308 |
| 158 | Ga0074263_110270 | 3300005485 | Unclassified | 1555 |
| 159 | Ga0466704_118851 | 3300042643 | Bacteria | 6564 |
| 160 | Ga0466709_279463 | 3300042648 | Bacteria | 6581 |
| 161 | Ga0466708_079792 | 3300042652 | Bacteria | 4153 |
| 162 | Ga0466708_081092 | 3300042652 | Bacteria | 1594 |
| 163 | Ga0466708_099906 | 3300042652 | Bacteria | 39915 |
| 164 | Ga0466708_359482 | 3300042652 | Unclassified | 3815 |
| 165 | Ga0466727_094611 | 3300042655 | Bacteria | 1519 |
| 166 | Ga0466712_212169 | 3300042614 | Unclassified | 2856 |
| 167 | Ga0466711_276484 | 3300042615 | Bacteria | 13022 |
| 168 | Ga0466711_277171 | 3300042615 | Bacteria | 12165 |
| 169 | Ga0466715_138252 | 3300042616 | Bacteria | 14142 |
| 170 | Ga0466723_005097 | 3300042618 | Bacteria | 11859 |
| 171 | Ga0466723_057924 | 3300042618 | Bacteria | 13629 |
| 172 | Ga0466726_156797 | 3300042619 | Bacteria | 1135 |
| 173 | Ga0466705_150491 | 3300042612 | Bacteria | 6695 |
| 174 | Ga0466705_233032 | 3300042612 | Bacteria | 2296 |
| 175 | Ga0466732_230258 | 3300042656 | Bacteria | 1159 |
| 176 | Ga0466733_054928 | 3300042659 | Bacteria | 2075 |
| 177 | Ga0466733_072934 | 3300042659 | Bacteria | 22175 |
| 178 | Ga0456237_0002700 | 3300041968 | Bacteria | 2864 |
| 179 | Ga0466690_047832 | 3300042590 | Bacteria | 3843 |
| 180 | Ga0466692_012890 | 3300042591 | Bacteria | 2940 |
| 181 | Ga0466691_104204 | 3300042593 | Bacteria | 18796 |
| 182 | Ga0123357_10191366 | 3300009784 | Bacteria | 2356 |
| 183 | Ga0466713_094137 | 3300042602 | Bacteria | 3020 |
| 184 | Ga0466716_261756 | 3300042605 | Unclassified | 5824 |
| 185 | Ga0466719_413155 | 3300042606 | Bacteria | 17050 |
| 186 | Ga0466720_027387 | 3300042607 | Bacteria | 3557 |
| 187 | Ga0466720_101623 | 3300042607 | Unclassified | 2681 |
| 188 | Ga0466722_108500 | 3300042609 | Bacteria | 4661 |
| 189 | JGI24698J34947_10012898 | 3300002449 | Bacteria | 4566 |
| 190 | Ga0466704_274679 | 3300042643 | Unclassified | 4590 |
| 191 | Ga0466709_197423 | 3300042648 | Unclassified | 3679 |
| 192 | Ga0466709_238907 | 3300042648 | Bacteria | 3463 |
| 193 | Ga0466708_154833 | 3300042652 | Unclassified | 4685 |
| 194 | Ga0466708_376099 | 3300042652 | Bacteria | 7065 |
| 195 | Ga0466708_398831 | 3300042652 | Unclassified | 2201 |
| 196 | Ga0466715_077393 | 3300042616 | Bacteria | 22122 |
| 197 | Ga0466718_019533 | 3300042617 | Bacteria | 16064 |
| 198 | Ga0466723_089476 | 3300042618 | Bacteria | 4862 |
| 199 | Ga0466723_352563 | 3300042618 | Bacteria | 4918 |
| 200 | Ga0466726_257453 | 3300042619 | Bacteria | 4852 |
| 201 | Ga0466726_318151 | 3300042619 | Bacteria | 19413 |
| 202 | Ga0466726_464428 | 3300042619 | Bacteria | 2073 |
| 203 | Ga0466728_048045 | 3300042620 | Bacteria | 4155 |
| 204 | Ga0466705_208204 | 3300042612 | Bacteria | 12378 |
| 205 | Ga0466733_095470 | 3300042659 | Bacteria | 2349 |
| 206 | Ga0466690_239591 | 3300042590 | Bacteria | 10570 |
| 207 | Ga0466690_304421 | 3300042590 | Unclassified | 3107 |
| 208 | Ga0466692_171766 | 3300042591 | Bacteria | 1808 |
| 209 | Ga0466691_090347 | 3300042593 | Bacteria | 10907 |
| 210 | Ga0466694_391099 | 3300042594 | Bacteria | 7746 |
| 211 | Ga0466696_004446 | 3300042596 | Bacteria | 5807 |
| 212 | Ga0466696_390299 | 3300042596 | Bacteria | 6811 |
| 213 | Ga0466716_309900 | 3300042605 | Bacteria | 5759 |
| 214 | Ga0466719_504451 | 3300042606 | Bacteria | 1816 |
| 215 | Ga0466720_212076 | 3300042607 | Bacteria | 14182 |
| 216 | Ga0466722_045251 | 3300042609 | Bacteria | 2934 |
| 217 | Ga0466722_183638 | 3300042609 | Bacteria | 13507 |
| 218 | JGI24698J34947_10000877 | 3300002449 | Bacteria | 15197 |
| 219 | JGI24702J35022_10001174 | 3300002462 | Bacteria | 16292 |
| 220 | Ga0466704_289449 | 3300042643 | Bacteria | 13176 |
| 221 | Ga0466704_290161 | 3300042643 | Bacteria | 2492 |
| 222 | Ga0466709_064903 | 3300042648 | Bacteria | 14125 |
| 223 | Ga0466709_420478 | 3300042648 | Bacteria | 3781 |
| 224 | Ga0466705_389624 | 3300042612 | Bacteria | 2980 |
| 225 | Ga0466712_242700 | 3300042614 | Bacteria | 2855 |
| 226 | Ga0466711_327894 | 3300042615 | Bacteria | 4790 |
| 227 | Ga0466715_101265 | 3300042616 | Bacteria | 4189 |
| 228 | Ga0466715_205101 | 3300042616 | Bacteria | 12493 |
| 229 | Ga0466718_083344 | 3300042617 | Bacteria | 41687 |
| 230 | Ga0466723_026424 | 3300042618 | Bacteria | 20136 |
| 231 | Ga0466723_041118 | 3300042618 | Bacteria | 6380 |
| 232 | Ga0466723_173817 | 3300042618 | Unclassified | 4198 |
| 233 | Ga0466728_064632 | 3300042620 | Unclassified | 6286 |
| 234 | Ga0466728_076019 | 3300042620 | Bacteria | 6135 |
| 235 | Ga0466728_216835 | 3300042620 | Unclassified | 4435 |
| 236 | Ga0466728_337027 | 3300042620 | Unclassified | 4473 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF02653 | BPD_transp_2 | Branched-chain amino acid transport system / permease component | 54 | 371 | 0.86 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.