Protein Family IF10087

Metagenome Isolate
143 Members
92 Samples
101 Scaffolds
326.93 Avg Length

🧬 Representative Sequence

ID
3300042654|Ga0466725_332846|Ga0466725_332846_27347_28456
Length
369 aa
Sequence
VLLNWYRNLQNLNKKMNYLITGGSGFIGSHLAEHLLKSGHFVINIDNFDDFYDYKIKIENTLESIGKSPKFQYSDKETDIQKLISETKSDNYILYYQDIRDIFGLRKIFENHKIDLIIHLAALAGVRPSIQKPLEYEEVNIRGSMNLWELCKEFNIKKFVCSSSSSVYGNNEKIPFSETDNVDKPISPYAATKKCGEILGHVYHHLYKIDMVQLRFFTVYGPRQRPDLAIHKFSKLILENREIPFYGDGSTSRDYTFIDDIIDGVLKSIKYLEQHENVYEIINLGENEVINLNQMLSEIEENLGKKAKKNILPMQAGDVPKTNADITKAEKIIDYRPNTKFNIGIKKFMAWFLEKTDNVQRKGFLPNLE

📊 Sample Types

Isolate 29.4%
Metagenome 70.6%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 25.0%
Unclassified 20.5%
Kalotermitidae 12.5%
Elmidae 8.0%
Culicidae 5.7%
Scarabaeidae 4.5%
Formicidae 4.5%
Pyralidae 3.4%
Rhinotermitidae 2.3%
Passalidae 2.3%
Drosophilidae 2.3%
Apidae 2.3%
Cambaridae 1.1%
Tenebrionidae 1.1%
Aphididae 1.1%
Termopsidae 1.1%
Noctuidae 1.1%
Calliphoridae 1.1%

🌳 Taxonomy

Archaea 1
Bacteria 138
Eukaryota 0
Viruses 0
Unclassified 4

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2864923010 Elizabethkingia anophelis S00177 Isolate Elmidae
2 2820918931 Unclassified Actinobacteria Emb289P3bin56 Isolate Unclassified
3 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
4 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
5 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
6 3300009460 Microbial communities of aphids from Pistacia texana in Langtry, TX, USA - Geopemphigus sp. seqcov Metagenome
7 2921902974 Chryseobacterium sp. cx-624 Isolate Cambaridae
8 2820052737 Unclassified Proteobacteria Th196P3bin127 Isolate Unclassified
9 3300056842 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) Metagenome Tenebrionidae
10 643886085 Bacillus thuringiensis sv. berliner ATCC 10792 Isolate Pyralidae
11 643886091 Bacillus thuringiensis sv. thuringiensis T01001 Isolate Pyralidae
12 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
13 2847090942 Elizabethkingia anophelis Ag1 Isolate Culicidae
14 2864882932 Chryseobacterium shingense S00136 Isolate Elmidae
15 2864891731 Chryseobacterium defluvii S00151 Isolate Elmidae
16 2687453786 Chryseobacterium culicis DSM 23031 Isolate Unclassified
17 2820100407 Unclassified Proteobacteria Lab288P1bin48 Isolate Unclassified
18 2820137450 Unclassified Proteobacteria Emb289P3bin120 Isolate Unclassified
19 646311952 Sebaldella termitidis ATCC 33386 Isolate Unclassified
20 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
21 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
22 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
23 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
24 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
25 2841168549 Agromyces protaetiae FW100M-8 Isolate Scarabaeidae
26 2529292732 Elizabethkingia anophelis R26 Isolate Culicidae
27 2820075487 Unclassified Proteobacteria Nt197P3bin122 Isolate Unclassified
28 2820111668 Unclassified Proteobacteria Emb289P4bin34 Isolate Unclassified
29 2820141685 Unclassified Proteobacteria Emb289P3bin118 Isolate Unclassified
30 2998929858 Bacteroidetes endosymbiont of Geopemphigus sp. GspS2-BC2016 Isolate Aphididae
31 3300002464 Anopheles gambiae gut viral communities from New Mexico State University, USA - SM1 Metagenome Culicidae
32 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
33 2864831662 Chryseobacterium sediminis S00068 Isolate Elmidae
34 2508501067 Opitutaceae bacterium TAV1 Isolate Unclassified
35 2820685979 Unclassified Firmicutes Co191P1bin81 Isolate Unclassified
36 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
37 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
38 8020009074 Elizabethkingia anophelis MSU001 Isolate Culicidae
39 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
40 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
41 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
42 2883683260 Protaetiibacter larvae KACC 19322 Isolate Scarabaeidae
43 2706794701 Opitutaceae bacterium TSB47 Isolate Rhinotermitidae
44 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
45 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
46 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
47 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
48 3300007129 Ant gut microbial communities from Cephalotes atratus, Brazil Metagenome Formicidae
49 3300012805 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E11 MG Metagenome
50 3300012814 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E6 MG Metagenome
51 3300003097 Cutworm gut microbial communities from Hangzhou, China Metagenome Noctuidae
52 2837204985 Lysinimonas sp. 2DFWR-13 Isolate Scarabaeidae
53 2864948220 Elizabethkingia anophelis S00205 Isolate Elmidae
54 2731957677 Alkalihalobacillus trypoxylicola NBRC 102646 Isolate Scarabaeidae
55 2767802234 Cytobacillus kochii BDGP4 Isolate Drosophilidae
56 2820096063 Unclassified Proteobacteria Lab288P3bin136 Isolate Unclassified
57 2820106212 Unclassified Proteobacteria Emb289P4bin44 Isolate Unclassified
58 2820673891 Unclassified Firmicutes Co191P3bin18 Isolate Unclassified
59 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
60 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
61 651324002 Acetonema longum APO-1, DSM 6540 Isolate Kalotermitidae
62 8065497608 Tellurirhabdus bombi IE-0392 Isolate Apidae
63 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
64 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
65 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
66 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
67 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
68 8114076984 Elizabethkingia anophelis R26 Isolate Culicidae
69 2827179085 Paenibacillus alvei DSM 29 Isolate Apidae
70 2852431164 Brevibacillus laterosporus BON707 Isolate Calliphoridae
71 2864788197 Elizabethkingia anophelis S00027 Isolate Elmidae
72 2864822740 Chryseobacterium shigense S00064 Isolate Elmidae
73 2912849059 Bacillus thuringiensis sv. berliner ATCC 10792 Isolate Pyralidae
74 2209111004 Macrotermes natalensis queen gut microbiome Metagenome Termitidae
75 2820602899 Unclassified Firmicutes Emb289P1bin51 Isolate Unclassified
76 2820457604 Unclassified Firmicutes Lab288P3bin15 Isolate Unclassified
77 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
78 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
79 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
80 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
81 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
82 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
83 3300000036 Passalidae beetle gut microbial communities from Costa Rica - Gallery material (4MSU+4BSU+3MSU+3BSU) Metagenome Passalidae
84 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
85 3300002931 Ant worker gut metagenome for colony PL010 Metagenome Formicidae
86 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
87 3300005309 Drosophila gut microbial communities from New York, USA - Drosophila neotestacea male 1 gut Metagenome Drosophilidae
88 3300007052 Ant gut microbial communities from Cephalotes eduarduli, Brazil Metagenome Formicidae
89 3300007192 Ant gut microbial communities from Cephalotes persimplex, Brazil Metagenome Formicidae
90 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
91 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
92 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0415639_196033 3300038395 Bacteria 1288
2 Ga0466693_360027 3300042592 Bacteria 3645
3 Ga0466699_354518 3300042597 Bacteria 1827
4 Ga0123357_10362332 3300009784 Bacteria 1371
5 Ga0123355_10017678 3300009826 Bacteria 11279
6 Ga0123356_10030897 3300010049 Bacteria 5011
7 Ga0123356_10141898 3300010049 Bacteria 2371
8 Ga0123353_10000362 3300010167 Bacteria 55430
9 Ga0123353_10001076 3300010167 Bacteria 33242
10 Ga0123353_10016173 3300010167 Bacteria 10888
11 Ga0123353_10033809 3300010167 Bacteria 7966
12 Ga0123353_10522802 3300010167 Bacteria 1721
13 Ga0123353_10692436 3300010167 Bacteria 1433
14 Ga0466700_295192 3300042600 Bacteria 1172
15 Ga0466722_112613 3300042609 Bacteria 1672
16 Ga0466711_501172 3300042615 Bacteria 4808
17 Ga0466715_209158 3300042616 Bacteria 2926
18 IMNBGM34_c001092 3300000036 Bacteria 5342
19 JGI24705J35276_12209727 3300002504 Bacteria 1805
20 Ga0052191_103274 3300003097 Bacteria 1718
21 Ga0102734_1001147 3300007129 Bacteria 19702
22 Ga0415639_131465 3300038395 Bacteria 5013
23 Ga0466696_108528 3300042596 Archaea 2987
24 Ga0123357_10011246 3300009784 Bacteria 11460
25 Ga0466714_137832 3300042603 Unclassified 1916
26 Ga0466711_224592 3300042615 Bacteria 117488
27 Ga0466703_380031 3300042636 Bacteria 1445
28 Ga0072940_1397315 3300005200 Bacteria 3534
29 Ga0160453_105906 3300012814 Unclassified 1886
30 Ga0466690_386787 3300042590 Bacteria 1775
31 Ga0466693_401018 3300042592 Bacteria 1688
32 Ga0123356_10205590 3300010049 Bacteria 2013
33 Ga0123353_10105182 3300010167 Bacteria 4548
34 Ga0160464_101571 3300012805 Bacteria 7023
35 Ga0466707_091708 3300042601 Bacteria 4777
36 Ga0466714_106711 3300042603 Bacteria 3208
37 Ga0466720_223911 3300042607 Bacteria 1044
38 Ga0466704_064412 3300042643 Unclassified 12861
39 Ga0466725_332846 3300042654 Bacteria 33341
40 Meta3P_1006087 3300002464 Bacteria 7153
41 CVPL010W_10000064 3300002931 Bacteria 69184
42 Ga0074306_1020443 3300005309 Bacteria 2967
43 Ga0103268_1009975 3300007192 Bacteria 1976
44 Ga0415639_019791 3300038395 Bacteria 9059
45 Ga0466693_136784 3300042592 Bacteria 3337
46 Ga0123356_10523166 3300010049 Bacteria 1344
47 Ga0123353_10117987 3300010167 Bacteria 4268
48 Ga0123353_10507282 3300010167 Bacteria 1755
49 Ga0466701_038908 3300042598 Bacteria 8630
50 Ga0466700_398660 3300042600 Bacteria 2419
51 Ga0466705_441857 3300042612 Bacteria 4195
52 Ga0466730_071786 3300042625 Bacteria 741189
53 Ga0466704_512733 3300042643 Bacteria 4662
54 JGI24705J35276_12236920 3300002504 Bacteria 9274
55 Ga0072941_1366973 3300005201 Bacteria 1311
56 Ga0415639_006574 3300038395 Bacteria 19511
57 Ga0123355_10017689 3300009826 Bacteria 11273
58 Ga0123353_10030893 3300010167 Bacteria 8286
59 Ga0123353_10462957 3300010167 Bacteria 1862
60 Ga0466701_031837 3300042598 Bacteria 1220
61 Ga0466724_07109 3300042649 Bacteria 285871
62 JGI24695J34938_10000037 3300002450 Bacteria 100752
63 Ga0072941_1062077 3300005201 Bacteria 1621
64 Ga0102736_1006056 3300007052 Bacteria 1507
65 Ga0466696_194976 3300042596 Bacteria 6506
66 Ga0123355_10001049 3300009826 Bacteria 38266
67 Ga0123356_10003235 3300010049 Bacteria 17118
68 Ga0123356_10127634 3300010049 Bacteria 2486
69 Ga0123353_10007796 3300010167 Bacteria 14532
70 Ga0123353_10082834 3300010167 Bacteria 5160
71 Ga0466701_064263 3300042598 Bacteria 8586
72 Ga0466714_149316 3300042603 Bacteria 10795
73 Ga0466719_060947 3300042606 Bacteria 103920
74 Ga0466722_046153 3300042609 Bacteria 2458
75 Ga0466718_061297 3300042617 Bacteria 1576
76 Ga0466730_071971 3300042625 Bacteria 2714
77 Ga0466727_177761 3300042655 Bacteria 12042
78 2211830559 2209111004 Bacteria 23886
79 Ga0127649_100534 3300009460 Bacteria 84789
80 Ga0466733_117265 3300042659 Bacteria 18083
81 Ga0415639_158152 3300038395 Unclassified 3128
82 Ga0123357_10086554 3300009784 Bacteria 4100
83 Ga0123355_10199649 3300009826 Bacteria 2925
84 Ga0123356_10002569 3300010049 Bacteria 19382
85 Ga0123353_10005961 3300010167 Bacteria 16132
86 Ga0123353_10196887 3300010167 Bacteria 3175
87 Ga0123354_10259634 3300010882 Bacteria 1738
88 Ga0466713_117047 3300042602 Bacteria 144191
89 Ga0466714_074198 3300042603 Bacteria 829090
90 Ga0466716_162586 3300042605 Bacteria 6012
91 Ga0466719_090720 3300042606 Bacteria 4147
92 IMNBL1DRAFT_c0004056 3300000062 Bacteria 8984
93 Ga0562377_0062 3300056842 Bacteria 463693
94 Ga0123355_10484170 3300009826 Bacteria 1537
95 Ga0123353_10357591 3300010167 Bacteria 2196
96 Ga0466707_140127 3300042601 Bacteria 4878
97 Ga0466715_125793 3300042616 Bacteria 1462
98 Ga0466723_044181 3300042618 Bacteria 301962
99 Ga0466703_357444 3300042636 Bacteria 6076
100 JGI24702J35022_10004625 3300002462 Bacteria 8155
101 Ga0123357_10000025 3300009784 Bacteria 131170

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF01370 Epimerase NAD dependent epimerase/dehydratase family 19 285 0.94
PF04321 RmlD_sub_bind RmlD substrate binding domain 16 321 0.89
PF16363 GDP_Man_Dehyd GDP-mannose 4,6 dehydratase 77 347 0.86
PF01073 3Beta_HSD 3-beta hydroxysteroid dehydrogenase/isomerase family 19 275 0.8
PF07993 NAD_binding_4 Male sterility protein 112 210 0.78
PF02719 Polysacc_synt_2 Polysaccharide biosynthesis protein 19 286 0.72

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.