Protein Family IF10039
Metagenome
Isolate
132
Members
35
Samples
131
Scaffolds
154.28
Avg Length
Representative Sequence
- ID
- 3300042654|Ga0466725_057554|Ga0466725_057554_466_987
- Length
- 173 aa
- Sequence
- MPYYFCIFAKIFKFTNMARYRIKLTQSEVQQLSSIVKKGSHTTQSYRAAYVLLNCDEGDFSQGKSTNEQIAKILKINMRTIDRIKKRCIEGGVESALERAASTRVYEKKVDGDLEAKIVQLCCSEPPKGFSKWSLRMLADKVVELGYVAELSHVSVHNTLKKTNLSPGKSSLG
Sample Types
Isolate
0.8%
Metagenome
99.2%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
76.5%
Kalotermitidae
17.6%
Unclassified
2.9%
Rhinotermitidae
2.9%
Taxonomy
Archaea
7
Bacteria
94
Eukaryota
0
Viruses
0
Unclassified
31
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 2 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 3 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 4 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 5 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 6 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 7 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 8 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 9 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 10 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 11 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 12 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 13 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 14 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 15 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 16 | 2820740053 | Unclassified Bacteroidetes Th196P3bin81 | Isolate | Unclassified |
| 17 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 18 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 19 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 20 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 21 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 22 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 23 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 24 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 25 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 26 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 27 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 28 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 29 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 30 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 31 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 32 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 33 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 34 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 35 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466697_103335 | 3300042611 | Bacteria | 1244 |
| 2 | Ga0466710_188364 | 3300042613 | Bacteria | 2660 |
| 3 | Ga0466710_359409 | 3300042613 | Unclassified | 1359 |
| 4 | Ga0123356_10230963 | 3300010049 | Bacteria | 1914 |
| 5 | Ga0123356_10355563 | 3300010049 | Bacteria | 1590 |
| 6 | Ga0123356_11075456 | 3300010049 | Unclassified | 973 |
| 7 | Ga0123356_11770345 | 3300010049 | Bacteria | 767 |
| 8 | Ga0123353_10886352 | 3300010167 | Bacteria | 1217 |
| 9 | Ga0123353_11185762 | 3300010167 | Bacteria | 1004 |
| 10 | Ga0123354_10331681 | 3300010882 | Bacteria | 1386 |
| 11 | Ga0466695_092295 | 3300042595 | Archaea | 1452 |
| 12 | Ga0466701_094073 | 3300042598 | Bacteria | 1539 |
| 13 | Ga0466717_006634 | 3300042604 | Bacteria | 1811 |
| 14 | Ga0466717_167784 | 3300042604 | Bacteria | 2193 |
| 15 | Ga0466721_270061 | 3300042608 | Bacteria | 1442 |
| 16 | Ga0466721_337532 | 3300042608 | Unclassified | 1404 |
| 17 | Ga0466722_136978 | 3300042609 | Bacteria | 1292 |
| 18 | Ga0466731_123243 | 3300042622 | Bacteria | 1144 |
| 19 | Ga0466731_196303 | 3300042622 | Unclassified | 1759 |
| 20 | Ga0466709_119597 | 3300042648 | Bacteria | 1288 |
| 21 | Ga0466697_130895 | 3300042611 | Bacteria | 1221 |
| 22 | Ga0123357_10561242 | 3300009784 | Bacteria | 903 |
| 23 | Ga0123356_10414340 | 3300010049 | Bacteria | 1488 |
| 24 | Ga0123356_10932858 | 3300010049 | Archaea | 1039 |
| 25 | Ga0123353_11000666 | 3300010167 | Bacteria | 1123 |
| 26 | Ga0123354_10450962 | 3300010882 | Bacteria | 1042 |
| 27 | Ga0415639_034738 | 3300038395 | Unclassified | 1089 |
| 28 | Ga0466656_338192 | 3300042550 | Bacteria | 1718 |
| 29 | Ga0466719_168356 | 3300042606 | Bacteria | 2188 |
| 30 | Ga0466697_046337 | 3300042611 | Archaea | 1069 |
| 31 | Ga0466734_049321 | 3300042623 | Bacteria | 1819 |
| 32 | Ga0466734_173560 | 3300042623 | Bacteria | 1495 |
| 33 | Ga0466725_057554 | 3300042654 | Archaea | 1460 |
| 34 | Ga0072941_1107393 | 3300005201 | Archaea | 1375 |
| 35 | Ga0466697_174724 | 3300042611 | Bacteria | 1281 |
| 36 | Ga0466710_370074 | 3300042613 | Bacteria | 1513 |
| 37 | Ga0123356_10260811 | 3300010049 | Unclassified | 1817 |
| 38 | Ga0123353_11632387 | 3300010167 | Unclassified | 812 |
| 39 | Ga0466656_167375 | 3300042550 | Bacteria | 1748 |
| 40 | Ga0466656_195047 | 3300042550 | Bacteria | 1516 |
| 41 | Ga0466657_305055 | 3300042582 | Bacteria | 1828 |
| 42 | Ga0466693_252218 | 3300042592 | Bacteria | 1619 |
| 43 | Ga0466691_054532 | 3300042593 | Bacteria | 23434 |
| 44 | Ga0466694_400267 | 3300042594 | Bacteria | 2344 |
| 45 | Ga0466701_058479 | 3300042598 | Bacteria | 1379 |
| 46 | Ga0466721_127957 | 3300042608 | Bacteria | 1413 |
| 47 | Ga0466721_236233 | 3300042608 | Bacteria | 1882 |
| 48 | Ga0466697_017631 | 3300042611 | Unclassified | 1242 |
| 49 | Ga0466697_024306 | 3300042611 | Bacteria | 1203 |
| 50 | Ga0466702_227647 | 3300042635 | Bacteria | 1502 |
| 51 | JGI24705J35276_12171519 | 3300002504 | Unclassified | 1296 |
| 52 | JGI24696J40584_12758359 | 3300002834 | Bacteria | 804 |
| 53 | Ga0466711_219030 | 3300042615 | Bacteria | 1209 |
| 54 | Ga0123356_11258546 | 3300010049 | Unclassified | 904 |
| 55 | Ga0123356_12148360 | 3300010049 | Unclassified | 697 |
| 56 | Ga0123353_10555296 | 3300010167 | Bacteria | 1655 |
| 57 | Ga0466657_383494 | 3300042582 | Bacteria | 3412 |
| 58 | Ga0466694_189003 | 3300042594 | Bacteria | 1072 |
| 59 | Ga0466695_064557 | 3300042595 | Bacteria | 1408 |
| 60 | Ga0466701_015854 | 3300042598 | Bacteria | 1178 |
| 61 | Ga0466717_080733 | 3300042604 | Unclassified | 1376 |
| 62 | Ga0466717_294400 | 3300042604 | Bacteria | 1426 |
| 63 | Ga0466731_011845 | 3300042622 | Archaea | 1098 |
| 64 | JGI24705J35276_12161505 | 3300002504 | Unclassified | 1235 |
| 65 | Ga0466697_179398 | 3300042611 | Bacteria | 1618 |
| 66 | Ga0466711_013513 | 3300042615 | Bacteria | 1602 |
| 67 | Ga0466711_069998 | 3300042615 | Bacteria | 1432 |
| 68 | Ga0123355_10776967 | 3300009826 | Bacteria | 1075 |
| 69 | Ga0123356_10519200 | 3300010049 | Unclassified | 1349 |
| 70 | Ga0123356_13236775 | 3300010049 | Unclassified | 567 |
| 71 | Ga0123353_11426140 | 3300010167 | Unclassified | 888 |
| 72 | Ga0123354_10469753 | 3300010882 | Unclassified | 1003 |
| 73 | Ga0466694_165265 | 3300042594 | Unclassified | 1865 |
| 74 | Ga0466694_239613 | 3300042594 | Bacteria | 1388 |
| 75 | Ga0466695_145209 | 3300042595 | Unclassified | 1234 |
| 76 | Ga0466699_238780 | 3300042597 | Bacteria | 1373 |
| 77 | Ga0466722_246116 | 3300042609 | Unclassified | 4733 |
| 78 | Ga0466697_025422 | 3300042611 | Bacteria | 1068 |
| 79 | Ga0466725_282976 | 3300042654 | Bacteria | 1715 |
| 80 | JGI24705J35276_12173622 | 3300002504 | Unclassified | 1311 |
| 81 | JGI24696J40584_12914360 | 3300002834 | Archaea | 1284 |
| 82 | Ga0072940_1028251 | 3300005200 | Bacteria | 794 |
| 83 | Ga0466697_116332 | 3300042611 | Bacteria | 1748 |
| 84 | Ga0466697_282319 | 3300042611 | Bacteria | 24360 |
| 85 | Ga0123356_10225506 | 3300010049 | Bacteria | 1934 |
| 86 | Ga0123356_10450627 | 3300010049 | Unclassified | 1435 |
| 87 | Ga0466656_076360 | 3300042550 | Bacteria | 2352 |
| 88 | Ga0466721_103405 | 3300042608 | Bacteria | 1529 |
| 89 | Ga0466698_007157 | 3300042610 | Bacteria | 2057 |
| 90 | Ga0466697_044142 | 3300042611 | Bacteria | 1012 |
| 91 | Ga0466731_073846 | 3300042622 | Bacteria | 1503 |
| 92 | Ga0466734_048603 | 3300042623 | Unclassified | 1585 |
| 93 | Ga0466697_182654 | 3300042611 | Bacteria | 1688 |
| 94 | Ga0466710_016334 | 3300042613 | Bacteria | 1551 |
| 95 | Ga0123356_10300909 | 3300010049 | Bacteria | 1709 |
| 96 | Ga0123356_10385590 | 3300010049 | Bacteria | 1535 |
| 97 | Ga0123356_11512552 | 3300010049 | Bacteria | 828 |
| 98 | Ga0123353_10557488 | 3300010167 | Bacteria | 1651 |
| 99 | Ga0123354_10331811 | 3300010882 | Bacteria | 1385 |
| 100 | Ga0123354_10430647 | 3300010882 | Unclassified | 1087 |
| 101 | Ga0466656_160144 | 3300042550 | Bacteria | 1370 |
| 102 | Ga0466657_399943 | 3300042582 | Bacteria | 1409 |
| 103 | Ga0466690_087385 | 3300042590 | Bacteria | 1327 |
| 104 | Ga0466694_079615 | 3300042594 | Bacteria | 1356 |
| 105 | Ga0466699_096649 | 3300042597 | Bacteria | 1253 |
| 106 | Ga0466701_096196 | 3300042598 | Bacteria | 1166 |
| 107 | Ga0466700_187857 | 3300042600 | Bacteria | 1991 |
| 108 | Ga0466717_044151 | 3300042604 | Unclassified | 1701 |
| 109 | Ga0466717_104498 | 3300042604 | Bacteria | 1515 |
| 110 | Ga0466698_474074 | 3300042610 | Bacteria | 3361 |
| 111 | Ga0466698_510444 | 3300042610 | Unclassified | 1373 |
| 112 | Ga0466697_032881 | 3300042611 | Bacteria | 1374 |
| 113 | Ga0466731_330130 | 3300042622 | Bacteria | 1785 |
| 114 | Ga0466734_088598 | 3300042623 | Unclassified | 1607 |
| 115 | Ga0466702_142737 | 3300042635 | Bacteria | 1061 |
| 116 | Ga0466703_217956 | 3300042636 | Bacteria | 1343 |
| 117 | Ga0466725_344762 | 3300042654 | Bacteria | 1762 |
| 118 | JGI24705J35276_12177991 | 3300002504 | Unclassified | 1343 |
| 119 | Ga0072941_1036990 | 3300005201 | Bacteria | 1169 |
| 120 | Ga0072941_1219118 | 3300005201 | Bacteria | 2904 |
| 121 | Ga0466710_366380 | 3300042613 | Bacteria | 1991 |
| 122 | Ga0123356_10498741 | 3300010049 | Bacteria | 1373 |
| 123 | Ga0123356_10560540 | 3300010049 | Bacteria | 1304 |
| 124 | Ga0123354_10292910 | 3300010882 | Bacteria | 1556 |
| 125 | Ga0123354_10548900 | 3300010882 | Unclassified | 872 |
| 126 | Ga0466656_080643 | 3300042550 | Unclassified | 1302 |
| 127 | Ga0466656_361678 | 3300042550 | Unclassified | 1530 |
| 128 | Ga0466700_195185 | 3300042600 | Bacteria | 2991 |
| 129 | Ga0466721_006629 | 3300042608 | Bacteria | 1081 |
| 130 | Ga0466731_328297 | 3300042622 | Bacteria | 1566 |
| 131 | Ga0466734_089947 | 3300042623 | Bacteria | 1313 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.